CHRNA3 Protein, Human (His-SUMO)
CHRNA3 Protein, a critical contributor to collagen fibrillogenesis, regulates the rate of fibril formation and influences the assembly and organization of collagen fibrils. Binding to both type I and type II collagen, CHRNA3 plays a pivotal role in shaping the structural integrity of the extracellular matrix. CHRNA3 Protein, Human (His-SUMO) is the recombinant human-derived CHRNA3 protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CHRNA3 Protein, a critical contributor to collagen fibrillogenesis, regulates the rate of fibril formation and influences the assembly and organization of collagen fibrils. Binding to both type I and type II collagen, CHRNA3 plays a pivotal role in shaping the structural integrity of the extracellular matrix. CHRNA3 Protein, Human (His-SUMO) is the recombinant human-derived CHRNA3 protein, expressed by E. coli , with N-10*His, N-SUMO labeled tag.
Background
Fibromodulin, a protein with a pivotal role in collagen fibrillogenesis, significantly influences the rate of fibril formation and may serve as a primary contributor to this process. Known to bind both type I and type II collagen, Fibromodulin plays a crucial role in modulating the assembly and organization of collagen fibrils. Its impact on the dynamics of fibrillogenesis suggests its involvement in shaping the structural integrity of the extracellular matrix.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His;N-SUMO
-
Accession
P32297 (S32-L240)
-
Molecular Construction
-
N-term
-
10*His-SUMO
-
CHRNA3 (S32-L240)
Accession # P32297 -
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
CHRNA3; Cholinergic Receptor, Nicotinic Alpha 3; Cholinergic Receptor Nicotinic Alpha 3 Subunit; NACHRA3; Neuronal Nicotinic Acetylcholine Receptor, Alpha3 Subunit; Acetylcholine Receptor, Nicotinic, Alpha 3 (Neuronal); Cholinergic Receptor, Nicotinic, Al
-
AA Sequence
SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
-
Predicted Molecular Mass
44.6 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
