Claudin-4/CLDN4 Protein-Nanodisc, Human (HEK293,His, Strep)
Claudin-4/CLDN4 protein-VLP is a channel-forming tight junction protein that promotes paracellular chloride transport in the kidney. It is essential for the reabsorption of filtered chloride in the collecting duct. Claudin-4/CLDN4 Protein-Nanodisc, Human (HEK293,His, Strep) is the recombinant human-derived Claudin-4/CLDN4 protein, expressed by HEK293, with C-Strep and N-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Claudin-4/CLDN4 protein-VLP is a channel-forming tight junction protein that promotes paracellular chloride transport in the kidney. It is essential for the reabsorption of filtered chloride in the collecting duct. Claudin-4/CLDN4 Protein-Nanodisc, Human (HEK293,His, Strep) is the recombinant human-derived Claudin-4/CLDN4 protein, expressed by HEK293, with C-Strep and N-His labeled tag.
Background
Claudin-4 (CLDN4) protein, a channel-forming tight junction protein, serves as a pivotal mediator of paracellular chloride transport in the kidney, particularly influencing the critical process of paracellular chloride reabsorption in the collecting ducts. Within tight junctions, claudins, including CLDN4, play a crucial role in the specific obliteration of intercellular spaces, exhibiting calcium-independent cell-adhesion activity. This protein establishes direct interactions with key tight junction components such as TJP1/ZO-1, TJP2/ZO-2, and TJP3/ZO-3. Additionally, CLDN4 engages with EPHA2, where EPHA2-mediated phosphorylation of CLDN4 may contribute to the regulation of tight junctions. Notably, CLDN4 also interacts with other claudin family members, such as CLDN1 and CLDN8, further emphasizing its involvement in complex tight junction networks.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag N-10*His;C-Strep
-
Accession
O14493 (M1-V209)
-
Gene ID1364
-
Protein Length
Full Length
-
Synonyms
CLDN4; HCPE-R; Prev. CPETR1; CPE-Receptor; Prev. CPETR; Claudin-4; WBSCR8; CPER; CPE-R; Clostridium Perfringens Enterotoxin Receptor; Williams-Beuren Syndrome Chromosomal Region 8 Protein; Claudin; Claudin 4; Clostridium Perfringens Enterotoxin Receptor 1
-
AA Sequence
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
-
Predicted Molecular Mass
24.6 kDa
-
Molecular Weight
Approximately 53 kDa & 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
