Claudin-4/CLDN4 Protein-Nanodisc, Human (HEK293,His, Strep)

Claudin-4/CLDN4 protein-VLP is a channel-forming tight junction protein that promotes paracellular chloride transport in the kidney. It is essential for the reabsorption of filtered chloride in the collecting duct. Claudin-4/CLDN4 Protein-Nanodisc, Human (HEK293,His, Strep) is the recombinant human-derived Claudin-4/CLDN4 protein, expressed by HEK293, with C-Strep and N-His labeled tag.

Claudin-4 (CLDN4) protein, a channel-forming tight junction protein, serves as a pivotal mediator of paracellular chloride transport in the kidney, particularly influencing the critical process of paracellular chloride reabsorption in the collecting ducts. Within tight junctions, claudins, including CLDN4, play a crucial role in the specific obliteration of intercellular spaces, exhibiting calcium-independent cell-adhesion activity. This protein establishes direct interactions with key tight junction components such as TJP1/ZO-1, TJP2/ZO-2, and TJP3/ZO-3. Additionally, CLDN4 engages with EPHA2, where EPHA2-mediated phosphorylation of CLDN4 may contribute to the regulation of tight junctions. Notably, CLDN4 also interacts with other claudin family members, such as CLDN1 and CLDN8, further emphasizing its involvement in complex tight junction networks.

Human

HEK293

N-10*His;C-Strep

O14493 (M1-V209)

1364

Full Length

MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

Approximately 53.2 kDa 21.7 kDa,based on SDS-PAGE under reducing conditions.

≥ 80%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.