Claudin-4/CLDN4 Protein-VLP, Human (HEK293)
Claudin-4/CLDN4 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Claudin-4/CLDN4 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
Background
Claudin-4 (CLDN4) protein, a channel-forming tight junction protein, serves as a pivotal mediator of paracellular chloride transport in the kidney, particularly influencing the critical process of paracellular chloride reabsorption in the collecting ducts. Within tight junctions, claudins, including CLDN4, play a crucial role in the specific obliteration of intercellular spaces, exhibiting calcium-independent cell-adhesion activity. This protein establishes direct interactions with key tight junction components such as TJP1/ZO-1, TJP2/ZO-2, and TJP3/ZO-3. Additionally, CLDN4 engages with EPHA2, where EPHA2-mediated phosphorylation of CLDN4 may contribute to the regulation of tight junctions. Notably, CLDN4 also interacts with other claudin family members, such as CLDN1 and CLDN8, further emphasizing its involvement in complex tight junction networks.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
O14493 (M1-V209)
-
Gene ID1364
-
Molecular Construction
-
N-term
-
CLDN4 (M1-V209)
Accession # O14493 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CLDN4; HCPE-R; Prev. CPETR1; CPE-Receptor; Prev. CPETR; Claudin-4; WBSCR8; CPER; CPE-R; Clostridium Perfringens Enterotoxin Receptor; Williams-Beuren Syndrome Chromosomal Region 8 Protein; Claudin; Claudin 4; Clostridium Perfringens Enterotoxin Receptor 1
-
AA Sequence
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
-
Purity
Purity analysis by SDS-PAGE is not available for VLP proteins.
Product Properties
Solution
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
