1. Recombinant Proteins
  2. Others
  3. Claudin-4/CLDN4 Protein-VLP, Human (HEK293)

Claudin-4/CLDN4 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Claudin-4/CLDN4 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.

Background

Claudin-4 (CLDN4) protein, a channel-forming tight junction protein, serves as a pivotal mediator of paracellular chloride transport in the kidney, particularly influencing the critical process of paracellular chloride reabsorption in the collecting ducts. Within tight junctions, claudins, including CLDN4, play a crucial role in the specific obliteration of intercellular spaces, exhibiting calcium-independent cell-adhesion activity. This protein establishes direct interactions with key tight junction components such as TJP1/ZO-1, TJP2/ZO-2, and TJP3/ZO-3. Additionally, CLDN4 engages with EPHA2, where EPHA2-mediated phosphorylation of CLDN4 may contribute to the regulation of tight junctions. Notably, CLDN4 also interacts with other claudin family members, such as CLDN1 and CLDN8, further emphasizing its involvement in complex tight junction networks.

Species

Human

Source

HEK293

Tag

Tag Free

Accession

O14493 (M1-V209)

Gene ID

1364

Molecular Construction
N-term
CLDN4 (M1-V209)
Accession # O14493
C-term
Protein Length

Full Length

Synonyms
CLDN4; claudin 4; CPETR, CPETR1; claudin-4; Clostridium perfringens enterotoxin receptor 1; CPE R; hCPE R; WBSCR8; Williams Beuren syndrome chromosomal region 8 protein;
AA Sequence

MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

Purity

Purity analysis by SDS-PAGE is not available for VLP proteins.

Appearance

Solution.

Formulation

Supplied as 0.2 μm filtered solution of PBS, Arginine, pH7.4 with trehalose as protectant.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

Claudin-4/CLDN4 Protein-VLP, Human (HEK293) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Claudin-4/CLDN4 Protein-VLP, Human (HEK293)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Claudin-4/CLDN4 Protein-VLP, Human (HEK293)
Cat. No.:
HY-P704508
Quantity:
MCE Japan Authorized Agent: