Claudin-6/CLDN6 Protein-VLP, Human (HEK293, solution)
Based on 1 Customer Validation
Claudin-6/CLDN6 Protein-VLP, Human (HEK293) is recommended for SPR analysis, animal immunization, ELISA, PK assay. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Claudin-6/CLDN6 Protein-VLP, Human (HEK293) is recommended for SPR analysis, animal immunization, ELISA, PK assay. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.
Background
The Claudin-6/CLDN6 protein-VLP plays a crucial role in the specific obliteration of the intercellular space in tight junctions. It is involved in maintaining the integrity of the cell barrier, preventing leakage and maintaining cell polarity. Additionally, the protein acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells, facilitating viral infection.
Verified Bioactivity
1.Immobilized Human Claudin 6 VLP at 5 μg/mL(100 μl/Well). Dose response curve for Anti-Claudin 6 Antibody, mFc Tag with the EC50 of ≤5.5 ng/mL determined by ELISA.
2.Human Claudin 6 VLP immobilized on CM5 Chip can bind Anti-Claudin 6 Antibody with an affinity constant of 0.26 nM as determined in SPR assay (Biacore T200).
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P56747 (M1-V220)
-
Molecular Construction
-
N-term
-
CLDN6 (M1-V220)
Accession # P56747 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CLDN6; Claudin-6; Claudin 6; Skullin
-
AA Sequence
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
-
Predicted Molecular Mass
24.5 kDa
-
Purity
≥ 95%, as determined by HPLC.
Product Properties
Solution
1.Supplied as a 0.2 μm filtered solution of PBS, pH 7.4.
2.Supplied as a 0.2 μm filtered solution of PBS, 300 mM L-arginine, pH 7.4.
Notice: If you need it for immunization, water-soluble adjuvant is recommended.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
