Claudin-6/CLDN6 Protein-VLP, Mouse (HEK293)

Claudin-6/CLDN6 Protein-VLP, Mouse (HEK293) is recommended for animal immunization, ELISA, PK assay. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.

Claudin-6/CLDN6 Protein-VLP assumes a pivotal role in the targeted obliteration of the intercellular space within tight junctions, employing calcium-independent cell-adhesion activity. This protein not only participates in the essential process of intercellular adhesion but also directly engages with critical tight junction-associated proteins, including TJP1/ZO-1, TJP2/ZO-2, and TJP3/ZO-3. These interactions emphasize Claudin-6/CLDN6's integral role in the assembly and maintenance of tight junction complexes, contributing to the regulation of paracellular transport and cellular barrier functions. Furthermore, this protein exhibits additional interactions with CLDN1, CD81, and OCLN, underscoring its multifaceted involvement in cellular adhesion and tight junction dynamics.

Immobilized Mouse Claudin 6 VLP at 5μg/ml (100μl/Well) on the plate. Dose response curve for Anti-Claudin6 Antibody, mFc Tag with the EC₅₀ of less than 3.5 ng/ml determined by ELISA.

Mouse

HEK293

Tag Free

Q9Z262 (M1-V219)

54419  [NCBI]

Full Length

MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDRNSKSRLVLISGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGPSEYPTKNYV

The target protein has a predicted MW of 24.60 kDa.

≥ 95%, as determined by HPLC.

Solution.

Supplied as a 0.22 μm filtered solution of PBS, 300 mM L-Arginine, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.