Claudin-6/CLDN6 Protein-VLP, Mouse (HEK293)
Based on 1 Customer Validation
Claudin-6/CLDN6 Protein-VLP, Mouse (HEK293) is recommended for animal immunization, ELISA, PK assay. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Claudin-6/CLDN6 Protein-VLP, Mouse (HEK293) is recommended for animal immunization, ELISA, PK assay. If VLP control is required, it is recommended HY-P702775. May have binding signals with Anti-His antibodies.
Background
Claudin-6/CLDN6 Protein-VLP assumes a pivotal role in the targeted obliteration of the intercellular space within tight junctions, employing calcium-independent cell-adhesion activity. This protein not only participates in the essential process of intercellular adhesion but also directly engages with critical tight junction-associated proteins, including TJP1/ZO-1, TJP2/ZO-2, and TJP3/ZO-3. These interactions emphasize Claudin-6/CLDN6's integral role in the assembly and maintenance of tight junction complexes, contributing to the regulation of paracellular transport and cellular barrier functions. Furthermore, this protein exhibits additional interactions with CLDN1, CD81, and OCLN, underscoring its multifaceted involvement in cellular adhesion and tight junction dynamics.
Verified Bioactivity
Immobilized Mouse Claudin 6 VLP at 5μg/ml (100μl/Well) on the plate. Dose response curve for Anti-Claudin6 Antibody, mFc Tag with the EC50 of less than 3.5 ng/ml determined by ELISA.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag Tag Free
-
Accession
Q9Z262 (M1-V219)
-
Molecular Construction
-
N-term
-
CLDN6 (M1-V219)
Accession # Q9Z262 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CLDN6; Claudin-6; Claudin 6; Skullin
-
AA Sequence
MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDRNSKSRLVLISGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGPSEYPTKNYV
-
Predicted Molecular Mass
24.6 kDa
-
Purity
≥ 95%, as determined by HPLC.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, 300 mM L-Arginine, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
