1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. CLEC-6
  6. CLEC4D Protein, Rat (HEK293, Fc)

CLEC4D, a calcium-dependent lectin, detects DAMPs and PAMPs from bacteria and fungi. It interacts with FCER1G in myeloid cells, forming a functional complex that activates signaling pathways and promotes antigen-presenting cell maturation and T-cell priming. CLEC4D also combats fungal infections and contributes to antigen uptake for clearance or presentation to T-cells. Its interaction with CLEC4E strengthens the interaction with FCER1G. CLEC4D Protein, Rat (HEK293, Fc) is the recombinant rat-derived CLEC4D protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CLEC4D, a calcium-dependent lectin, detects DAMPs and PAMPs from bacteria and fungi. It interacts with FCER1G in myeloid cells, forming a functional complex that activates signaling pathways and promotes antigen-presenting cell maturation and T-cell priming. CLEC4D also combats fungal infections and contributes to antigen uptake for clearance or presentation to T-cells. Its interaction with CLEC4E strengthens the interaction with FCER1G. CLEC4D Protein, Rat (HEK293, Fc) is the recombinant rat-derived CLEC4D protein, expressed by HEK293 , with N-hFc labeled tag.

Background

CLEC4D, a calcium-dependent lectin, serves as a pivotal pattern recognition receptor (PRR) within the innate immune system, identifying damage-associated molecular patterns (DAMPs) and pathogen-associated molecular patterns (PAMPs) from bacteria and fungi. Notably, it recognizes alpha-mannans on C.albicans hyphae and mycobacterial trehalose 6,6'-dimycolate (TDM). In myeloid cells, CLEC4D interacts with the signaling adapter Fc receptor gamma chain/FCER1G, likely facilitated by CLEC4E, forming a functional complex. Binding of mycobacterial TDM or C.albicans alpha-mannans to this receptor complex triggers phosphorylation of the immunoreceptor tyrosine-based activation motif (ITAM) of FCER1G, activating SYK, CARD9, and NF-kappa-B. This activation cascade drives maturation of antigen-presenting cells, shaping antigen-specific priming of T-cells towards effector T-helper 1 and T-helper 17 cell subtypes. Additionally, the CLEC4D-CLEC6A heterodimer actively combats fungal infections, while CLEC4D, functioning as an endocytic receptor, may contribute to antigen uptake at infection sites for either antigen clearance or processing and subsequent presentation to T-cells. The disulfide-linked heterodimer with CLEC4E reinforces interaction with FCER1G, forming a functional complex.

Species

Rat

Source

HEK293

Tag

N-hFc

Accession

Q69FH1 (W48-K218)

Gene ID
Molecular Construction
N-term
hFc
CLEC4D (W48-K218)
Accession # Q69FH1
C-term
Protein Length

Extracellular Domain

Synonyms
C-type lectin domain family 4 member D; CLEC-6; Dectin-3; CD368; CLECSF8
AA Sequence

WKRGSALKFSDYHTRLTCILEEPQPGATGGTWTCCPVSWRAFQSNCYFALNDNQTWHESERNCSGMSSHLVTINTEAEQDFVTQLLDEQFSYFLGLSYEKVEGQWQWVDKTPFNPNVVFWKVGEPKDSMEEDCVVLVYDQDKWVWNDFPCHFEMGRICKLPGATFDWNPSK

Predicted Molecular Mass
48.4 kDa
Molecular Weight

Approximately 53 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CLEC4D Protein, Rat (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CLEC4D Protein, Rat (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLEC4D Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P76835
Quantity:
MCE Japan Authorized Agent: