1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. MDL-1/CLEC5A
  6. CLEC5A/MDL-1 Protein, Mouse (HEK293, Fc)

CLEC5A/MDL-1 Protein positively regulates osteoclastogenesis and acts as a cell surface receptor signaling via TYROBP. Its expression relies on the TYROBP interaction and it plays a role in regulating inflammatory responses. CLEC5A/TYROBP/HCST complex formation highlights its intricate involvement in immune and inflammatory processes. CLEC5A/MDL-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CLEC5A/MDL-1 Protein positively regulates osteoclastogenesis and acts as a cell surface receptor signaling via TYROBP. Its expression relies on the TYROBP interaction and it plays a role in regulating inflammatory responses. CLEC5A/TYROBP/HCST complex formation highlights its intricate involvement in immune and inflammatory processes. CLEC5A/MDL-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

CLEC5A/MDL-1 Protein acts as a positive regulator of osteoclastogenesis and functions as a cell surface receptor that signals via TYROBP. This interaction is vital for CLEC5A cell surface expression. Additionally, the protein plays a role in regulating inflammatory responses. While existing as a monomer or homodimer, the majority of CLEC5A is expressed as a monomeric form on macrophages. It forms a trimolecular complex, CLEC5A/TYROBP/HCST, mainly dependent on TYROBP. The interaction with TYROBP and HCST further underscores the intricate signaling network involved in the functions of CLEC5A in immune and inflammatory processes.

Species

Mouse

Source

HEK293

Tag

N-hFc

Accession

Q9R007-3 (Y26-K190)

Gene ID
Molecular Construction
N-term
hFc
CLEC5A/MDL-1 (Y26-K190)
Accession # Q9R007-3
C-term
Protein Length

Extracellular Domain

Synonyms
MDL-1; CLECSF5; MDL1; CLEC5A; DAP12-associating lectin 1
AA Sequence

YFPQVFGKSNDGFVPTESYGTTSVQNVSQIFGRNDESTMPTRSYGTVCPRNWDFHQGKCFFFSFSESPWKDSMDYCATQGSTLAIVNTPEKLKYLQDIAGIENYFIGLVRQPGEKKWRWINNSVFNGNVTNQDQNFDCVTIGLTKTYDAASCEVSYRWICEMNAK

Molecular Weight

64-68 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

CLEC5A/MDL-1 Protein, Mouse (HEK293, Fc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CLEC5A/MDL-1 Protein, Mouse (HEK293, Fc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CLEC5A/MDL-1 Protein, Mouse (HEK293, Fc)
Cat. No.:
HY-P77906
Quantity:
MCE Japan Authorized Agent: