CLEC5A/MDL-1 Protein, Mouse (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

CLEC5A/MDL-1 Protein positively regulates osteoclastogenesis and acts as a cell surface receptor signaling via TYROBP. Its expression relies on the TYROBP interaction and it plays a role in regulating inflammatory responses. CLEC5A/TYROBP/HCST complex formation highlights its intricate involvement in immune and inflammatory processes. CLEC5A/MDL-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CLEC5A/MDL-1 Protein positively regulates osteoclastogenesis and acts as a cell surface receptor signaling via TYROBP. Its expression relies on the TYROBP interaction and it plays a role in regulating inflammatory responses. CLEC5A/TYROBP/HCST complex formation highlights its intricate involvement in immune and inflammatory processes. CLEC5A/MDL-1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-hFc labeled tag.

Background

CLEC5A/MDL-1 Protein acts as a positive regulator of osteoclastogenesis and functions as a cell surface receptor that signals via TYROBP. This interaction is vital for CLEC5A cell surface expression. Additionally, the protein plays a role in regulating inflammatory responses. While existing as a monomer or homodimer, the majority of CLEC5A is expressed as a monomeric form on macrophages. It forms a trimolecular complex, CLEC5A/TYROBP/HCST, mainly dependent on TYROBP. The interaction with TYROBP and HCST further underscores the intricate signaling network involved in the functions of CLEC5A in immune and inflammatory processes.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • hFc
    • CLEC5A/MDL-1 (Y26-K190)
      Accession # Q9R007-3
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CLEC5A; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Superfamily Member 5; Prev. CLECSF5; MDL1; C-Type Lectin Domain Family 5 Member A; C-Type Lectin Domain Family 5, Member A; MDL-1; Myeloid DAP12-Associating Lectin-1; C-Type Lecti

  • AA Sequence

    YFPQVFGKSNDGFVPTESYGTTSVQNVSQIFGRNDESTMPTRSYGTVCPRNWDFHQGKCFFFSFSESPWKDSMDYCATQGSTLAIVNTPEKLKYLQDIAGIENYFIGLVRQPGEKKWRWINNSVFNGNVTNQDQNFDCVTIGLTKTYDAASCEVSYRWICEMNAK

  • Predicted Molecular Mass

    46.2 kDa

  • Molecular Weight

    Approximately 64-68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00