CLEC5A/MDL-1 Protein, Rhesus Macaque (HEK293, His)
Based on 1 Customer Validation
CLEC5A Protein is a cell surface receptor that signals via TYROBP, and functions as a positive regulator of osteoclastogenesis. CLEC5A Protein regulates inflammatory responses. CLEC5A/MDL-1 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Rhesus Macaque
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
CLEC5A Protein is a cell surface receptor that signals via TYROBP, and functions as a positive regulator of osteoclastogenesis. CLEC5A Protein regulates inflammatory responses. CLEC5A/MDL-1 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived CLEC5A/MDL-1 protein, expressed by HEK293 , with N-His labeled tag.
Background
CLEC5A Protein is a critical macrophage receptor for dengue virus serotypes 1-4. The binding of CLEC5A Protein to dengue virus triggers signaling through the phosphorylation of TYROBP, and not results in viral entry, but stimulates pro-inflammatory cytokine release[1][2][3].
Verified Bioactivity
Measured by its binding ability in a functional ELISA. When Recombinant Human Galectin-9 Protein is immobilized at 1 µg/mL (100 µL/well) can bind Recombinant Rhesus Macaque CLEC5A. The ED50 for this effect is 15.33 ng/mL.
Technical Parameters
-
Species Rhesus Macaque
-
Source HEK293
-
Tag N-6*His
-
Accession
XP_001085243 (P28-K188)
-
Molecular Construction
-
N-term
-
His
-
CLEC5A (P28-K188)
Accession # XP_001085243 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CLEC5A; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Superfamily Member 5; Prev. CLECSF5; MDL1; C-Type Lectin Domain Family 5 Member A; C-Type Lectin Domain Family 5, Member A; MDL-1; Myeloid DAP12-Associating Lectin-1; C-Type Lecti
-
AA Sequence
PQIFNKSNDGFTTTRSYGTDSQIFGSSSPSPNGFIPTRSYGTVCPEDWEFYQERCFLLPTSESSWNESRDFCKRKGSTLAIVNTPEKLKFLQDIADTEKYFIGLIYNREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDIRYRRICEKNAK
-
Molecular Weight
Approximately 25-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Watson AA, et al. Structural flexibility of the macrophage dengue virus receptor CLEC5A: implications for ligand binding and signaling. J Biol Chem. 2011;286(27):24208-24218. [Content Brief]
[2]. Chen ST, et al. CLEC5A is critical for dengue-virus-induced lethal disease. Nature. 2008;453(7195):672-676. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
