CMG-2/ANTXR2 Protein, Human (HEK293, His)

The CMG-2/ANTXR2 protein, acting as a receptor for anthrax toxin, binds to collagen IV and laminin, suggesting its role in extracellular matrix adhesion. Gene mutations are associated with juvenile hyaline fibromatosis and infantile systemic hyalinosis. Multiple isoforms have been found. It is expressed in various tissues, including the prostate and endometrium. CMG-2/ANTXR2 Protein, Human (HEK293, His) is the recombinant human-derived CMG-2/ANTXR2 protein, expressed by HEK293 , with C-His labeled tag.

The CMG-2/ANTXR2 protein serves as a receptor for anthrax toxin and exhibits a binding affinity for collagen IV and laminin, indicating its potential involvement in extracellular matrix adhesion. Mutations in this gene have been identified as the cause of juvenile hyaline fibromatosis and infantile systemic hyalinosis. Several transcript variants encoding different isoforms have been discovered for this gene. It shows a wide expression pattern across various tissues, including the prostate, endometrium, and 21 other tissues. This information is provided by RefSeq as of March 2009.

Human

HEK293

C-8*His

P58335-4/NP_477520.2 (Q34-G318)

118429  [NCBI]

Extracellular Domain

QEQPSCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSCTEILELQPSSVCVGEEFQIVLSGRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSLIVTATECSNG

Approximately 38-43 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.