CMG-2/ANTXR2 Protein, Human (HEK293, His)
The CMG-2/ANTXR2 protein, acting as a receptor for anthrax toxin, binds to collagen IV and laminin, suggesting its role in extracellular matrix adhesion. Gene mutations are associated with juvenile hyaline fibromatosis and infantile systemic hyalinosis. Multiple isoforms have been found. It is expressed in various tissues, including the prostate and endometrium. CMG-2/ANTXR2 Protein, Human (HEK293, His) is the recombinant human-derived CMG-2/ANTXR2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CMG-2/ANTXR2 protein, acting as a receptor for anthrax toxin, binds to collagen IV and laminin, suggesting its role in extracellular matrix adhesion. Gene mutations are associated with juvenile hyaline fibromatosis and infantile systemic hyalinosis. Multiple isoforms have been found. It is expressed in various tissues, including the prostate and endometrium. CMG-2/ANTXR2 Protein, Human (HEK293, His) is the recombinant human-derived CMG-2/ANTXR2 protein, expressed by HEK293 , with C-His labeled tag.
Background
The CMG-2/ANTXR2 protein serves as a receptor for anthrax toxin and exhibits a binding affinity for collagen IV and laminin, indicating its potential involvement in extracellular matrix adhesion. Mutations in this gene have been identified as the cause of juvenile hyaline fibromatosis and infantile systemic hyalinosis. Several transcript variants encoding different isoforms have been discovered for this gene. It shows a wide expression pattern across various tissues, including the prostate, endometrium, and 21 other tissues. This information is provided by RefSeq as of March 2009.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-8*His
-
Accession
P58335-4/NP_477520.2 (Q34-G318)
-
Molecular Construction
-
N-term
-
CMG-2 (Q34-G318)
Accession # P58335-4/NP_477520.2 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ANTXR2; FLJ31074; ANTXR Cell Adhesion Molecule 2; Anthrax Toxin Receptor 2, Isoform CRA_c; CMG-2; Anthrax Toxin Receptor; CMG2; ANTXR2 Protein; Anthrax Toxin Receptor 2; HFS; Capillary Morphogenesis Gene 2 Protein; ISH; Capillary Morphogenesis Protein 2;
-
AA Sequence
QEQPSCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIILPLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDGLVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSILAQSCTEILELQPSSVCVGEEFQIVLSGRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQLNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSLIVTATECSNG
-
Predicted Molecular Mass
31.8 kDa
-
Molecular Weight
Approximately 38-43 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
