CNR1 Protein-VLP, Human (HEK293, His)

CNR1 Protein-VLP, Human (HEK293, His) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P701236. Tags can only be detected under denaturing conditions.

The CNR1 Protein-VLP serves as a G-protein coupled receptor for endogenous cannabinoids (eCBs), including N-arachidonoylethanolamide (anandamide or AEA) and 2-arachidonoylglycerol (2-AG), as well as phytocannabinoids like delta(9)-tetrahydrocannabinol (THC). It mediates a range of cannabinoid-induced effects on food intake, memory, gastrointestinal motility, catalepsy, ambulatory activity, anxiety, and chronic pain, typically involving a reduction in cyclic AMP. In the hypothalamus, it exhibits a dual effect on mitochondrial respiration, increasing respiration at low doses and decreasing it at high doses through G-protein alpha-i protein activation and subsequent inhibition of mitochondrial soluble adenylate cyclase. Additionally, CNR1 inhibits leptin-induced reactive oxygen species (ROS) formation, mediates cannabinoid-induced increases in SREBF1 and FASN gene expression, and drives the release of orexigenic beta-endorphin from hypothalamic POMC neurons. In the hippocampus, it regulates cellular respiration and energy production in response to cannabinoids and is involved in cannabinoid-dependent processes like depolarization-induced suppression of inhibition (DSI). CNR1 also inhibits voltage-gated Ca(2+) channels in superior cervical ganglions and cerebral vascular smooth muscle cells, leading to vasodilation and decreased vascular tone. It induces leptin production in adipocytes, reduces LRP2-mediated leptin clearance in the kidney, and modulates lipid metabolism in adipose tissue and the liver. Furthermore, CNR1 peripherally modulates energy metabolism and, in obesity induced by a high carbohydrate diet, may affect mitochondrial dihydrolipoyl dehydrogenase/DLD expression in striated muscles and selected glucose/pyruvate metabolic enzymes. In response to cannabinoid anandamide, CNR1 elicits a pro-inflammatory response in macrophages, potentially contributing to the progression of type-2 diabetes and the loss of pancreatic beta-cells. Notably, CNR1 binds both 2-arachidonoylglycerol (2-AG) and anandamide.

Measured by its binding ability in a functional ELISA. Immobilized Human CNR1-VLPs at 1 μg/mL can bind Anti-CNR1 recombinant antibody , the EC₅₀ is <85 ng/mL.

Human

HEK293

C-10*His

P21554 (M1-L472)

1268  [NCBI]

Full Length

MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

54.6 kDa

Purity analysis by SDS-PAGE is not available for VLP proteins.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.