Complement C5a Protein, Mouse

7 Cited Publications
Kundenbewertung

Based on 7 publication(s) in Google Scholar

Complement C5a Protein, Mouse is a recombinant mouse complement component 5a (C5a). C5a is a potent pro-inflammatory mediator and acts as an essential part of the innate immune response.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.
  • Species: Mouse
  • Source: E. coli
  • Speicherung:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biologische Aktivität
  • Technical Parameters
  • Product Properties
  • Documentation
  • Verweise
  • Help & FAQs

Biologische Aktivität

Beschreibung

Complement C5a Protein, Mouse is a recombinant mouse complement component 5a (C5a). C5a is a potent pro-inflammatory mediator and acts as an essential part of the innate immune response[1].

Background

Complement component 5a (C5a), a 74 amino acid glycoprotein, is a potent pro-inflammatory mediator cleaved enzy matically from its precursor, C5, upon activation of the complement cascade[1].

Verified Bioactivity

Measured by its ability to induce N-acetyl-beta-D-glucosaminidase release from differentiated U937 human histiocytic lymphoma cells. The ED50 for this effect is 4-10 ng/mL.

Results
  • Experimental Validation Results for Complement C5a Protein, Mouse
    Measured by its ability to induce N-acetyl-beta-D-glucosaminidase release from differentiated U937 human histiocytic lymphoma cells. The ED50 for this effect is 7.196 ng/mL, corresponding to a specific activity is 1.389×105 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • C5a (N679-R755)
      Accession # P06684
    • C-term
  • Protein Length

    Partial

  • Synonyms

    rMuC5a; Complement C5; Hemolytic Complement; C5a

  • AA Sequence

    NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Reinheit

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for Complement C5a Protein, Mouse
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 350 mM NaCl, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Verweise

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Verdünnungsrechner

Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)

Konzentration (Stammlösung) Konzentration (Stammlösung)
×
Volumen (Stammlösung) Volumen (Stammlösung)
=
Konzentration (Ziellösung) Konzentration (Ziellösung)
×
Volumen (Ziellösung) Volumen (Ziellösung)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Angebot einholen Auf Lager

Other size
Angebot einholen
Please select quantity
Amount: USD 0.00