Complement C5a Protein, Mouse

Complement C5a Protein, Mouse is a recombinant mouse complement component 5a (C5a). C5a is a potent pro-inflammatory mediator and acts as an essential part of the innate immune response^[1].

Complement component 5a (C5a), a 74 amino acid glycoprotein, is a potent pro-inflammatory mediator cleaved enzy matically from its precursor, C5, upon activation of the complement cascade^[1].

Measured by its ability to induce N-acetyl-beta-D-glucosaminidase release from differentiated U937 human histiocytic lymphoma cells. The ED₅₀ for this effect is 4-10 ng/mL.

• 
  Measured by its ability to induce N-acetyl-beta-D-glucosaminidase release from differentiated U937 human histiocytic lymphoma cells. The ED₅₀ for this effect is 7.196 ng/mL, corresponding to a specific activity is 1.389×10⁵ units/mg.

Mouse

E. coli

Tag Free

P06684 (N679-R755)

15139  [NCBI]

Partial

NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR

Approximately 9 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 350 mM NaCl, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Helga D Manthey, et al. Complement component 5a (C5a). Int J Biochem Cell Biol. 2009 Nov;41(11):2114-7.  [Content Brief]