Copy Link Print Information

Complement C5a Protein, Mouse

7 Cited Publications
Customer Review

Based on 7 publication(s) in Google Scholar

Complement C5a Protein, Mouse is a recombinant mouse complement component 5a (C5a). C5a is a potent pro-inflammatory mediator and acts as an essential part of the innate immune response.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Complement C5a Protein, Mouse Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Complement C5a Protein, Mouse is a recombinant mouse complement component 5a (C5a). C5a is a potent pro-inflammatory mediator and acts as an essential part of the innate immune response[1].

Background

Complement component 5a (C5a), a 74 amino acid glycoprotein, is a potent pro-inflammatory mediator cleaved enzy matically from its precursor, C5, upon activation of the complement cascade[1].

Verified Bioactivity

Measured by its ability to induce N-acetyl-beta-D-glucosaminidase release from differentiated U937 human histiocytic lymphoma cells. The ED50 for this effect is 4-10 ng/mL.

Results
  • Experimental Validation Results for Complement C5a Protein, Mouse
    Measured by its ability to induce N-acetyl-beta-D-glucosaminidase release from differentiated U937 human histiocytic lymphoma cells. The ED50 for this effect is 7.196 ng/mL, corresponding to a specific activity is 1.389×105 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession

    P06684 (N679-R755)

  • Gene ID
    15139  [NCBI]
  • Molecular Construction
    • N-term
    • C5a (N679-R755)
      Accession # P06684
    • C-term
  • Protein Length

    Partial

  • Synonyms

    rMuC5a; Complement C5; Hemolytic Complement; C5a

  • AA Sequence

    NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

    • Experimental Validation Results for Complement C5a Protein, Mouse
      ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 350 mM NaCl, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Helga D Manthey, et al. Complement component 5a (C5a). Int J Biochem Cell Biol. 2009 Nov;41(11):2114-7. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

  • ≥ 95%, as determined by reducing SDS-PAGE.

  • Measured by its ability to induce N-acetyl-beta-D-glucosaminidase release from differentiated U937 human histiocytic lymphoma cells. The ED50 for this effect is 7.196 ng/mL, corresponding to a specific activity is 1.389×105 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to induce N-acetyl-beta-D-glucosaminidase release from differentiated U937 human histiocytic lymphoma cells. The ED50 for this effect is 7.196 ng/mL, corresponding to a specific activity is 1.389×105 units/mg.

  • 1/16

    Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Clin Immunol. 2025 Apr:273:110459. [Abstract]

    Customer Validation
     C5a (100 ng/ml, 48 h) stimulation increased CD44 expression in PECs at the protein level, effects that were blocked by PMX205 (5, 50, and 500 ng/ml, 48 h) in a dose-dependent manner.

  • 1/16

    Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Clin Immunol. 2025 Apr:273:110459. [Abstract]

    Customer Validation
     C5a (100 ng/ml, 48 h) stimulation increased CD44 expression in PECs at the mRNA level, effects that were blocked by PMX205 (5, 50, and 500 ng/ml, 48 h) in a dose-dependent manner.

  • 1/16

    Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Clin Immunol. 2025 Apr:273:110459. [Abstract]

    Customer Validation
     C5a (100 ng/ml, 48 h) exposure increased PEC-derived COL4A2 secretion and mRNA levels. This effect was reversed by PMX205 (5, 50, and 500 ng/ml, 48 h) in a dose-dependent manner.

  • 1/16

    Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Clin Immunol. 2025 Apr:273:110459. [Abstract]

    Customer Validation
     The proliferation of PECs increased by C5a (100 ng/ml, 48 h) was reduced by PMX205 (5, 50, and 500 ng/ml, 48 h) in a dose-dependent manner.

  • 1/16

    Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]

    Customer Validation
     Quantitative RT-PCR analysis of LC3B and p62 expression under low-glucose and high-glucose conditions with C3a and C5a treatment (both 100 nM, 24 h; n = 3).

  • 1/16

    Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]

    Customer Validation
     Western blot and quantitative analysis of LC3B and p62 expression under high-glucose conditions with C5a treatment (100 nM, 48 h; n = 4).

  • 1/16

    Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]

    Customer Validation
     Representative images of autophagy flux changes with C3a and C5a treatment (both 100 nM, 48 h; n = 3). 600× original magnification; scale bar, 10 µm. Data are presented as the means ± SEM, p < 0.05 was considered to be statistically significant.

  • Complement C5a Protein, Mouse Product Image
    1/16
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Experimental Validation Results for Complement C5a Protein, Mouse
  • Complement C5a Protein, Mouse Product Image

  • Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Clin Immunol. 2025 Apr:273:110459. [Abstract]

    C5a (100 ng/ml, 48 h) stimulation increased CD44 expression in PECs at the protein level, effects that were blocked by PMX205 (5, 50, and 500 ng/ml, 48 h) in a dose-dependent manner.

  • Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Clin Immunol. 2025 Apr:273:110459. [Abstract]

    C5a (100 ng/ml, 48 h) stimulation increased CD44 expression in PECs at the mRNA level, effects that were blocked by PMX205 (5, 50, and 500 ng/ml, 48 h) in a dose-dependent manner.

  • Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Clin Immunol. 2025 Apr:273:110459. [Abstract]

    C5a (100 ng/ml, 48 h) exposure increased PEC-derived COL4A2 secretion and mRNA levels. This effect was reversed by PMX205 (5, 50, and 500 ng/ml, 48 h) in a dose-dependent manner.

  • Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Clin Immunol. 2025 Apr:273:110459. [Abstract]

    The proliferation of PECs increased by C5a (100 ng/ml, 48 h) was reduced by PMX205 (5, 50, and 500 ng/ml, 48 h) in a dose-dependent manner.

  • Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]

    Quantitative RT-PCR analysis of LC3B and p62 expression under low-glucose and high-glucose conditions with C3a and C5a treatment (both 100 nM, 24 h; n = 3).

  • Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]

    Western blot and quantitative analysis of LC3B and p62 expression under high-glucose conditions with C5a treatment (100 nM, 48 h; n = 4).

  • Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]

    Representative images of autophagy flux changes with C3a and C5a treatment (both 100 nM, 48 h; n = 3). 600× original magnification; scale bar, 10 µm. Data are presented as the means ± SEM, p < 0.05 was considered to be statistically significant.