Complement C5a Protein, Mouse
Based on 7 publication(s) in Google Scholar
Complement C5a Protein, Mouse is a recombinant mouse complement component 5a (C5a). C5a is a potent pro-inflammatory mediator and acts as an essential part of the innate immune response.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Complement C5a Protein, Mouse is a recombinant mouse complement component 5a (C5a). C5a is a potent pro-inflammatory mediator and acts as an essential part of the innate immune response[1].
Complement component 5a (C5a), a 74 amino acid glycoprotein, is a potent pro-inflammatory mediator cleaved enzy matically from its precursor, C5, upon activation of the complement cascade[1].
Measured by its ability to induce N-acetyl-beta-D-glucosaminidase release from differentiated U937 human histiocytic lymphoma cells. The ED50 for this effect is 4-10 ng/mL.
Publications (7)
-
Journal Impact Factor
-
Most Recent
-
Signal Transduct Target Ther
A novel long-acting C5a-blocking cyclic peptide prevents sepsis-induced organ dysfunction via effective blockade of the inflammatory cascade. [Abstract]2025 Nov 5;10(1):362. PMID: 41188260 -
Phytomedicine
Xuanfei Baidu Decoction suppresses complement overactivation and ameliorates IgG immune complex-induced acute lung injury by inhibiting JAK2/STAT3/SOCS3 and NF-κB signaling pathway. [Abstract]2023 Jan:109:154551. PMID: 36610119 -
Cell Mol Neurobiol
Mild Hypothermia Alleviates Complement C5a-Induced Neuronal Autophagy During Brain Ischemia-Reperfusion Injury After Cardiac Arrest. [Abstract]2023 Jul;43(5):1957-1974. PMID: 36006573 -
J Gastroenterol
Blockade of C5aR1 alleviates liver inflammation and fibrosis in a mouse model of NASH by regulating TLR4 signaling and macrophage polarization. [Abstract]2023 Sep;58(9):894-907. PMID: 37227481 -
FASEB J
C-reactive protein inhibits C3a/C3aR-dependent podocyte autophagy in favor of diabetic kidney disease. [Abstract]2022 Jun;36(6):e22332. PMID: 35503088
Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]
Quantitative RT-PCR analysis of LC3B and p62 expression under low-glucose and high-glucose conditions with C3a and C5a treatment (both 100 nM, 24 h; n = 3).
Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]
Western blot and quantitative analysis of LC3B and p62 expression under high-glucose conditions with C5a treatment (100 nM, 48 h; n = 4).
Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: FASEB J. 2022 Jun;36(6):e22332. [Abstract]
Representative images of autophagy flux changes with C3a and C5a treatment (both 100 nM, 48 h; n = 3). 600× original magnification; scale bar, 10 µm. Data are presented as the means ± SEM, p < 0.05 was considered to be statistically significant.
-
Clin Immunol
Complement C5a and C5a receptor 1 mediates glomerular damage in focal segmental glomerulosclerosis. [Abstract]2025 Apr:273:110459. PMID: 39984108
Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Clin Immunol. 2025 Apr:273:110459. [Abstract]
C5a (100 ng/ml, 48 h) stimulation increased CD44 expression in PECs at the protein level, effects that were blocked by PMX205 (5, 50, and 500 ng/ml, 48 h) in a dose-dependent manner.
Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Clin Immunol. 2025 Apr:273:110459. [Abstract]
C5a (100 ng/ml, 48 h) stimulation increased CD44 expression in PECs at the mRNA level, effects that were blocked by PMX205 (5, 50, and 500 ng/ml, 48 h) in a dose-dependent manner.
Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Clin Immunol. 2025 Apr:273:110459. [Abstract]
C5a (100 ng/ml, 48 h) exposure increased PEC-derived COL4A2 secretion and mRNA levels. This effect was reversed by PMX205 (5, 50, and 500 ng/ml, 48 h) in a dose-dependent manner.
Complement C5a Protein, Mouse purchased from MedChemExpress. Usage Cited in: Clin Immunol. 2025 Apr:273:110459. [Abstract]
The proliferation of PECs increased by C5a (100 ng/ml, 48 h) was reduced by PMX205 (5, 50, and 500 ng/ml, 48 h) in a dose-dependent manner.
-
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P06684 (N679-R755)
-
Molecular Construction
-
N-term
-
C5a (N679-R755)
Accession # P06684 -
C-term
-
-
Protein Length
Partial
-
Synonyms
C5; C3 And PZP-Like Alpha-2-Macroglobulin Domain-Containing Protein 4; Complement C5; C5a Anaphylatoxin; CPAMD4; Prepro-C5; Complement Component 5; Anaphylatoxin C5a Analog; C5a; ECLZB; C5b; C5D
-
AA Sequence
NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 350 mM NaCl, pH 7.5.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)