CPLX2/Complexin-2 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

Complexin-2 (CPLX2) protein plays a key role in regulating synaptic vesicle dynamics, acting as a negative regulator of synaptic vesicle cluster formation. It precisely affects vesicle localization to the presynaptic membrane. CPLX2/Complexin-2 Protein, Human (His) is the recombinant human-derived CPLX2/Complexin-2 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Complexin-2 (CPLX2) protein plays a key role in regulating synaptic vesicle dynamics, acting as a negative regulator of synaptic vesicle cluster formation. It precisely affects vesicle localization to the presynaptic membrane. CPLX2/Complexin-2 Protein, Human (His) is the recombinant human-derived CPLX2/Complexin-2 protein, expressed by E. coli , with N-His labeled tag.

Background

Complexin-2 (CPLX2) protein assumes a pivotal role in modulating synaptic vesicle dynamics within postmitotic neurons. It acts as a negative regulator, specifically impeding the formation of synaptic vesicle clusters at the active zone, thereby influencing the precise localization of vesicles to the presynaptic membrane. Intriguingly, CPLX2 also exhibits a positive regulatory impact on the later stages of exocytosis, participating in the release of various cytoplasmic vesicles, including synaptic vesicles and other secretory vesicles. Its involvement extends to mast cell exocytosis, underlining its versatile role in cellular processes. Notably, CPLX2 achieves these regulatory effects through direct binding to the SNARE core complex, a molecular ensemble encompassing SNAP25, VAMP2, and STX1A, thereby contributing to the intricate orchestration of neurotransmitter release and vesicle dynamics at the synapse.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • CPLX2 (D2-K134)
      Accession # Q6PUV4
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CPLX2; CPX II; Complexin 2; Synaphin 1; Complexin-2; Synaphin-1; CPX-2; 921-L; DKFZp547D155; CPX2; Complexin II; Hfb1

  • AA Sequence

    DFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKYGLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK

  • Molecular Weight

    Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00