CREBBP Protein, Human (His)
CREBBP Protein, Human (His) is the recombinant human-derived CREBBP, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CREBBP Protein, Human (His) is the recombinant human-derived CREBBP, expressed by E. coli , with N-6*His labeled tag.
CREBBP is an acetyltransferase that acetylates histones (e.g., H3K18ac and H3K27ac), providing specific marks for transcriptional activation. It also acetylates non-histone proteins, including DDX21, FBL, IRF2, MAFG, NCOA3, POLR1E/PAF53, and FOXO1. CREBBP specifically binds phosphorylated CREB, enhancing its transcriptional activity toward cAMP-responsive genes, and acts as a coactivator for ALX1. It functions as a circadian transcriptional coactivator by enhancing the activity of NPAS2-BMAL1 and CLOCK-BMAL1 heterodimers. During nucleotide excision repair (NER), CREBBP acetylates PCNA, promoting its removal from chromatin and degradation. Additionally, it acetylates POLR1E/PAF53, reducing RNA polymerase I association with the rDNA promoter and coding regions. CREBBP inhibits DDX21 helicase activity via acetylation and prevents histone H2A Gln-105 methylation (H2AQ104me) by acetylating FBL. Beyond protein acetylation, CREBBP utilizes different acyl-CoA substrates (e.g., lactoyl-CoA) to mediate protein lactylation, such as MRE11 lactylation in response to DNA damage, promoting homologous recombination (HR)-mediated DNA double-strand break (DSB) repair. It also serves as a transcriptional coactivator for SMAD4 in the TGF-beta signaling pathway.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q92793-1 (R1081-G1197)
-
Gene ID1387
-
Molecular Construction
-
N-term
-
6*His
-
CREBBP (R1081-G1197)
Accession # Q92793-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CREBBP; CREB-Binding Protein; Prev. RSTS; CREB Binding Lysine Acetyltransferase; CBP; Rubinstein-Taybi Syndrome; CREB Binding Protein; Histone Acetyltransferase; KAT3A; CREBBP Protein; Protein-Lysine Acetyltransferase CREBBP; RSTS1; Histone Lysine Acetylt
-
AA Sequence
RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
-
Predicted Molecular Mass
14.9 kDa
-
Molecular Weight
Approximately 13-15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
