CTLA-4 Protein, Mouse (Biotinylated, HEK293, His)
CTLA-4 is a key inhibitory receptor that serves as a major negative regulator of T cell responses in immune regulation. Its unique property is that its affinity to B7 ligands (CD80/CD86) is significantly higher than that of CD28. CTLA-4 Protein, Mouse (Biotinylated, HEK293, His) is the recombinant mouse-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CTLA-4 is a key inhibitory receptor that serves as a major negative regulator of T cell responses in immune regulation. Its unique property is that its affinity to B7 ligands (CD80/CD86) is significantly higher than that of CD28. CTLA-4 Protein, Mouse (Biotinylated, HEK293, His) is the recombinant mouse-derived CTLA-4 protein, expressed by HEK293 , with C-His labeled tag.
Background
CTLA-4, a pivotal inhibitory receptor, acts as a primary negative regulator in T-cell responses, exerting its influence within the intricate network of immune modulation. This regulatory function arises from the distinct property of CTLA-4, showcasing significantly heightened affinity for its natural B7 family ligands, CD80 and CD86, in comparison to the cognate stimulatory coreceptor CD28. The homodimeric structure of CTLA-4, intricately linked by disulfide bonds, underscores its role as a molecular sentinel in immune regulation. Functionally, CTLA-4 binds avidly to CD80/B7-1 and CD86/B7.2, competitively engaging with these ligands to suppress T-cell activation and finely tune immune responses. Additionally, CTLA-4 interacts with ICOSLG, contributing to its multifaceted engagement in immune checkpoint pathways.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P09793 (E36-F162)
-
Molecular Construction
-
N-term
-
CTLA-4 (E36-F162)
Accession # P09793 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
CTLA4; Celiac Disease 3; Prev. CELIAC3; Cytotoxic T Lymphocyte Associated Antigen 4 Short Spliced Form; Prev. IDDM12; Cytotoxic T-Lymphocyte-Associated Serine Esterase-4; CTLA-4; Cytotoxic T-Lymphocyte-Associated Protein 4; CD152; Cytotoxic T-Lymphocyte A
-
AA Sequence
EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDF
-
Predicted Molecular Mass
15.3 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
