CXADR Protein, Mouse (HEK293, Fc)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

CXADR protein is a key component of the epithelial apical junction complex, which maintains the integrity of tight junctions and enables leukocyte migration through adhesive interactions with JAML. This interaction activates γ-δ T cells and promotes tissue repair through cell signaling involving PI3 kinase and MAP kinase. CXADR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CXADR protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CXADR protein is a key component of the epithelial apical junction complex, which maintains the integrity of tight junctions and enables leukocyte migration through adhesive interactions with JAML. This interaction activates γ-δ T cells and promotes tissue repair through cell signaling involving PI3 kinase and MAP kinase. CXADR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CXADR protein, expressed by HEK293 , with C-hFc labeled tag.

Background

As a vital component of the epithelial apical junction complex, CXADR serves a dual role in maintaining tight junction integrity as a homophilic cell adhesion molecule and facilitating the transepithelial migration of leukocytes through adhesive interactions with Junctional Adhesion Molecule-Like (JAML), a transmembrane protein on the plasma membrane of leukocytes. This interaction between CXADR and JAML is pivotal for the activation of gamma-delta T-cells, a specialized T-cell subpopulation residing in epithelial tissues, contributing to tissue homeostasis and repair. Upon binding to CXADR, JAML initiates downstream cell signaling in gamma-delta T-cells through pathways involving PI3-kinase and MAP kinases, resulting in T-cell proliferation and the production of cytokines and growth factors. This, in turn, stimulates the repair of epithelial tissues. CXADR may exist as a monomer or form homodimers, and it interacts with various proteins, including LNX, MAGI1, DLG4, PRKCABP, TJP1, CTNNB1, and MPDZ, with the latter recruiting MPDZ to intercellular contact sites. Additionally, CXADR engages in homodimeric interactions with JAML, contributing to its multifaceted cellular functions.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CXADR (L20-G237)
      Accession # P97792
    • hFc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CXADR; CVB3-Binding Protein; CXADR Cell Adhesion Molecule; HCVADR; CAR; HCAR; Coxsackie Virus And Adenovirus Receptor; 46 KD Coxsackievirus And Adenovirus Receptor (CAR) Protein; Coxsackievirus And Adenovirus Receptor; CXADR, Ig-Like Cell Adhesion Molecul

  • AA Sequence

    LSITTPEQRIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPSDNQIVDQVIILYSGDKIYDNYYPDLKGRVHFTSNDVKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKFLLTVLVKPSGTRCFVDGSEEIGNDFKLKCEPKEGSLPLQFEWQKLSDSQTMPTPWLAEMTSPVISVKNASSEYSGTYSCTVQNRVGSDQCMLRLDVVPPSNRAG

  • Molecular Weight

    Approximately 50-70 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00