GRO-alpha/CXCL1 Protein, Human (His)

GRO-alpha/CXCL1 protein attracts neutrophils and potentially contributes to inflammation through autocrine effects on endothelial cells. Processed forms of GRO-alpha, including GRO-alpha(4-73), GRO-alpha(5-73), and GRO-alpha(6-73), exhibit 30-fold greater chemotactic activity than the full-length protein. GRO-alpha/CXCL1 Protein, Human (His) is the recombinant human-derived GRO-alpha/CXCL1 protein, expressed by E. coli , with N-6*His labeled tag.

GRO-alpha/CXCL1 protein exhibits chemotactic activity for neutrophils and may play a role in inflammation, exerting its effects on endothelial cells in an autocrine fashion. In vitro studies indicate that processed forms of GRO-alpha, namely GRO-alpha(4-73), GRO-alpha(5-73), and GRO-alpha(6-73), display a significantly enhanced chemotactic activity, being 30-fold higher compared to the full-length protein.

Measured in a cell proliferation assay using HUVEC. The ED₅₀ for this effect is 0.8611 ng/mL, corresponding to a specific activity is 1.16×10⁶ units/mg.

• 
  Measured in a cell proliferation assay using HUVEC. The ED₅₀ for this effect is 0.8611 ng/mL, corresponding to a specific activity is 1.16×10⁶ units/mg.

Human

E. coli

N-6*His

P09341 (A35-N107)

2919  [NCBI]

Full Length of Mature Protein

ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN

Approximately 10-13 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose, 8% mannitol and 0.02% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.