GRO-alpha/CXCL1 Protein, Human (His)
Based on 1 Customer Validation
GRO-alpha/CXCL1 protein attracts neutrophils and potentially contributes to inflammation through autocrine effects on endothelial cells. Processed forms of GRO-alpha, including GRO-alpha(4-73), GRO-alpha(5-73), and GRO-alpha(6-73), exhibit 30-fold greater chemotactic activity than the full-length protein. GRO-alpha/CXCL1 Protein, Human (His) is the recombinant human-derived GRO-alpha/CXCL1 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
GRO-alpha/CXCL1 protein attracts neutrophils and potentially contributes to inflammation through autocrine effects on endothelial cells. Processed forms of GRO-alpha, including GRO-alpha(4-73), GRO-alpha(5-73), and GRO-alpha(6-73), exhibit 30-fold greater chemotactic activity than the full-length protein. GRO-alpha/CXCL1 Protein, Human (His) is the recombinant human-derived GRO-alpha/CXCL1 protein, expressed by E. coli , with N-6*His labeled tag.
GRO-alpha/CXCL1 protein exhibits chemotactic activity for neutrophils and may play a role in inflammation, exerting its effects on endothelial cells in an autocrine fashion. In vitro studies indicate that processed forms of GRO-alpha, namely GRO-alpha(4-73), GRO-alpha(5-73), and GRO-alpha(6-73), display a significantly enhanced chemotactic activity, being 30-fold higher compared to the full-length protein.
Measured in a cell proliferation assay using HUVEC. The ED50 for this effect is 0.8611 ng/mL, corresponding to a specific activity is 1.16×106 units/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P09341 (A35-N107)
-
Molecular Construction
-
N-term
-
6*His
-
CXCL1 (A35-N107)
Accession # P09341 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL1; Neutrophil-Activating Protein 3; Prev. GRO1; Fibroblast Secretory Protein; Prev. MGSA; C-X-C Motif Chemokine 1; Prev. FSP; GRO-Alpha(1-73); SCYB1; GRO1 Oncogene (Melanoma Growth-Stimulating Activity); NAP-3; Melanoma Growth Stimulatory Activity Alp
-
AA Sequence
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
-
Predicted Molecular Mass
11.9 kDa
-
Molecular Weight
Approximately 10-13 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose, 8% mannitol and 0.02% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
