Cyclophilin F/PPIF Protein, Human (HEK293, His, solution)

Customer Review

Based on 1 Customer Validation

Cyclophilin F/PPIF protein is a peptidyl prolyl cis-trans isomerase (PPIase) that catalyzes the isomerization of proline imide peptide bonds and may contribute to protein folding. It critically regulates the mitochondrial permeability transition pore (mPTP), affecting cell apoptosis or necrosis. Cyclophilin F/PPIF Protein, Human (HEK293, His, solution) is the recombinant human-derived Cyclophilin F/PPIF protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Cyclophilin F/PPIF protein is a peptidyl prolyl cis-trans isomerase (PPIase) that catalyzes the isomerization of proline imide peptide bonds and may contribute to protein folding. It critically regulates the mitochondrial permeability transition pore (mPTP), affecting cell apoptosis or necrosis. Cyclophilin F/PPIF Protein, Human (HEK293, His, solution) is the recombinant human-derived Cyclophilin F/PPIF protein, expressed by HEK293 , with C-His labeled tag.

Background

Cyclophilin F/PPIF Protein functions as a peptidyl-prolyl cis-trans isomerase (PPIase), playing a vital role in catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides, thereby potentially facilitating protein folding. Beyond its involvement in protein folding, Cyclophilin F/PPIF is a key player in the regulation of the mitochondrial permeability transition pore (mPTP), where its association with the mPTP is suggested to mask a binding site for inhibiting inorganic phosphate (Pi), ultimately promoting the open probability of the mPTP and leading to apoptosis or necrosis; however, the requirement for PPIase activity in this process is a matter of debate. Additionally, in collaboration with mitochondrial p53/TP53, Cyclophilin F/PPIF contributes to the activation of oxidative stress-induced necrosis. It further participates in modulating mitochondrial membrane F(1)F(0) ATP synthase activity and regulating mitochondrial matrix adenine nucleotide levels. Exhibiting anti-apoptotic activity independently of the mPTP, Cyclophilin F/PPIF, in cooperation with BCL2, effectively inhibits cytochrome c-dependent apoptosis, highlighting its multifaceted roles in mitochondrial function and cell survival mechanisms.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PPIF (C30-S207)
      Accession # P30405
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    PPIF; HCyP3; Peptidylprolyl Isomerase F; CyP-M; CypD; CYP3; Cyclophilin D; Peptidyl-Prolyl Cis-Trans Isomerase, Mitochondrial; Cyp-D; Peptidylprolyl Isomerase F (Cyclophilin F); Peptidyl-Prolyl Cis-Trans Isomerase F, Mitochondrial; Peptidyl-Prolyl Cis-Tra

  • AA Sequence

    CSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS

  • Predicted Molecular Mass

    20.3 kDa

  • Molecular Weight

    Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00