Cyclophilin F/PPIF Protein, Human (HEK293, His, solution)
Based on 1 Customer Validation
Cyclophilin F/PPIF protein is a peptidyl prolyl cis-trans isomerase (PPIase) that catalyzes the isomerization of proline imide peptide bonds and may contribute to protein folding. It critically regulates the mitochondrial permeability transition pore (mPTP), affecting cell apoptosis or necrosis. Cyclophilin F/PPIF Protein, Human (HEK293, His, solution) is the recombinant human-derived Cyclophilin F/PPIF protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Cyclophilin F/PPIF protein is a peptidyl prolyl cis-trans isomerase (PPIase) that catalyzes the isomerization of proline imide peptide bonds and may contribute to protein folding. It critically regulates the mitochondrial permeability transition pore (mPTP), affecting cell apoptosis or necrosis. Cyclophilin F/PPIF Protein, Human (HEK293, His, solution) is the recombinant human-derived Cyclophilin F/PPIF protein, expressed by HEK293 , with C-His labeled tag.
Background
Cyclophilin F/PPIF Protein functions as a peptidyl-prolyl cis-trans isomerase (PPIase), playing a vital role in catalyzing the cis-trans isomerization of proline imidic peptide bonds in oligopeptides, thereby potentially facilitating protein folding. Beyond its involvement in protein folding, Cyclophilin F/PPIF is a key player in the regulation of the mitochondrial permeability transition pore (mPTP), where its association with the mPTP is suggested to mask a binding site for inhibiting inorganic phosphate (Pi), ultimately promoting the open probability of the mPTP and leading to apoptosis or necrosis; however, the requirement for PPIase activity in this process is a matter of debate. Additionally, in collaboration with mitochondrial p53/TP53, Cyclophilin F/PPIF contributes to the activation of oxidative stress-induced necrosis. It further participates in modulating mitochondrial membrane F(1)F(0) ATP synthase activity and regulating mitochondrial matrix adenine nucleotide levels. Exhibiting anti-apoptotic activity independently of the mPTP, Cyclophilin F/PPIF, in cooperation with BCL2, effectively inhibits cytochrome c-dependent apoptosis, highlighting its multifaceted roles in mitochondrial function and cell survival mechanisms.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
P30405 (C30-S207)
-
Molecular Construction
-
N-term
-
PPIF (C30-S207)
Accession # P30405 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
PPIF; HCyP3; Peptidylprolyl Isomerase F; CyP-M; CypD; CYP3; Cyclophilin D; Peptidyl-Prolyl Cis-Trans Isomerase, Mitochondrial; Cyp-D; Peptidylprolyl Isomerase F (Cyclophilin F); Peptidyl-Prolyl Cis-Trans Isomerase F, Mitochondrial; Peptidyl-Prolyl Cis-Tra
-
AA Sequence
CSKGSGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS
-
Predicted Molecular Mass
20.3 kDa
-
Molecular Weight
Approximately 25-40 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (254 KB)
- English - EN (254 KB)
- Français - FR (254 KB)
- Deutsch - DE (254 KB)
- Norwegian - NO (254 KB)
- Español - ES (254 KB)
- Swedish - SV (254 KB)
- Italian - IT (254 KB)
- Korean - KR (254 KB)
- Portuguese - PT (254 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)