CRADD Protein, Human

As an adapter protein, CRADD forms a PIDDosome complex with PIDD1 and CASP2, activates CASP2 and initiates apoptosis. It also recruits CASP2 to the TNFR-1 signaling complex in the tumor necrosis factor-mediated pathway, interacting with RIPK1 and TRADD. CRADD Protein, Human is the recombinant human-derived CRADD protein, expressed by E. coli , with tag free.

CRADD serves as an adapter protein, forming the PIDDosome complex with PIDD1 and CASP2, which activates CASP2 and initiates apoptosis. Additionally, CRADD plays a role in the tumor necrosis factor-mediated signaling pathway by recruiting CASP2 to the TNFR-1 signaling complex through interactions with RIPK1 and TRADD. The direct interaction between CRADD and RIPK1, facilitated by their Death domains, underscores its involvement in these signaling cascades. Through its intricate associations, CRADD emerges as a key player in the regulation of apoptosis and cellular responses to TNF-mediated signals, highlighting its significance in fundamental cellular processes.

Human

E. coli

Tag Free

P78560 (M1-E199)

8738  [NCBI]

Full Length

MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVLSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE

Approximately 21 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.