DGKA Protein, Human (sf9, His-GST)
The DGKA protein converts diacylglycerol (DAG) into phosphatidic acid (PA), regulates its levels and serves as a central switch between signaling pathways. DGKA, Human (sf9, His-GST) is the recombinant human-derived DGKA protein, expressed by sf9 insect cells, with N-Avi labeled tag.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
The DGKA protein converts diacylglycerol (DAG) into phosphatidic acid (PA), regulates its levels and serves as a central switch between signaling pathways. DGKA, Human (sf9, His-GST) is the recombinant human-derived DGKA protein, expressed by sf9 insect cells, with N-Avi labeled tag.
Background
The DGKA protein functions as a diacylglycerol kinase, catalyzing the conversion of diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and intricately regulating the levels of these two bioactive lipids. This enzymatic activity positions DGKA as a central switch governing the signaling pathways activated by these second messengers, each exerting distinct effects in numerous biological processes. Additionally, DGKA plays a crucial role in the biosynthesis of complex lipids. Notably, it can efficiently phosphorylate 1-alkyl-2-acylglycerol in vitro, particularly if it contains an arachidonoyl group, showcasing its versatility. Moreover, DGKA is involved in the production of alkyl-lysophosphatidic acid, another bioactive lipid, achieved through the phosphorylation of 1-alkyl-2-acetyl glycerol. These multifaceted roles highlight DGKA's significance in lipid metabolism and its regulatory impact on diverse cellular pathways.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag N-His;N-GST
-
Accession
P23743-1 (M1-S735)
-
Gene ID1606
-
Molecular Construction
-
N-term
-
His-GST
-
(M1-S735)
Accession # P23743-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
DGKA; 80 KDa Diacylglycerol Kinase; Prev. DAGK1; DAG Kinase Alpha; Prev. DAGK; Diacylglycerol Kinase, Alpha (80kD); DGK-Alpha; Diacylglycerol Kinase; Diacylglycerol Kinase, Alpha 80kDa; DAG Kinase; Diacylglycerol Kinase Alpha; Diglyceride Kinase Alpha
-
AA Sequence
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipped with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
