Copy Link Print Information

DGKA Protein, Human (sf9, His, Myc)

Customer Review

Based on 1 Customer Validation

The DGKA protein converts diacylglycerol (DAG) into phosphatidic acid (PA), regulates its levels and serves as a central switch between signaling pathways. DGKA Protein, Human (sf9, His, Myc) is the recombinant human-derived DGKA, expressed by Sf9 insect cells, with C-Myc, N-10*His labeled tag. The total length of DGKA Protein, Human (sf9, His, Myc) is 735 a.a..

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • DGKA Protein, Human (sf9, His, Myc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The DGKA protein converts diacylglycerol (DAG) into phosphatidic acid (PA), regulates its levels and serves as a central switch between signaling pathways. DGKA Protein, Human (sf9, His, Myc) is the recombinant human-derived DGKA, expressed by Sf9 insect cells, with C-Myc, N-10*His labeled tag. The total length of DGKA Protein, Human (sf9, His, Myc) is 735 a.a..

Background

The DGKA protein functions as a diacylglycerol kinase, catalyzing the conversion of diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and intricately regulating the levels of these two bioactive lipids. This enzymatic activity positions DGKA as a central switch governing the signaling pathways activated by these second messengers, each exerting distinct effects in numerous biological processes. Additionally, DGKA plays a crucial role in the biosynthesis of complex lipids. Notably, it can efficiently phosphorylate 1-alkyl-2-acylglycerol in vitro, particularly if it contains an arachidonoyl group, showcasing its versatility. Moreover, DGKA is involved in the production of alkyl-lysophosphatidic acid, another bioactive lipid, achieved through the phosphorylation of 1-alkyl-2-acetyl glycerol. These multifaceted roles highlight DGKA's significance in lipid metabolism and its regulatory impact on diverse cellular pathways.

Verified Bioactivity

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-Myc;N-10*His
  • Accession

    P23743-1 (M1-S735)

  • Gene ID
    1606
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    DGKA; 80 KDa Diacylglycerol Kinase; Prev. DAGK1; DAG Kinase Alpha; Prev. DAGK; Diacylglycerol Kinase, Alpha (80kD); DGK-Alpha; Diacylglycerol Kinase; Diacylglycerol Kinase, Alpha 80kDa; DAG Kinase; Diacylglycerol Kinase Alpha; Diglyceride Kinase Alpha

  • AA Sequence

    MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS

  • Predicted Molecular Mass

    86.7 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • DGKA Protein, Human (sf9, His, Myc) Product Image
    1/16
  • DGKA Protein, Human (sf9, His, Myc) Product Image