DGKA Protein, Human (sf9, His, Myc)

The DGKA protein converts diacylglycerol (DAG) into phosphatidic acid (PA), regulates its levels and serves as a central switch between signaling pathways. DGKA Protein, Human (sf9, His, Myc) is the recombinant human-derived DGKA, expressed by Sf9 insect cells, with C-Myc, N-10*His labeled tag. The total length of DGKA Protein, Human (sf9, His, Myc) is 735 a.a..

The DGKA protein functions as a diacylglycerol kinase, catalyzing the conversion of diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and intricately regulating the levels of these two bioactive lipids. This enzymatic activity positions DGKA as a central switch governing the signaling pathways activated by these second messengers, each exerting distinct effects in numerous biological processes. Additionally, DGKA plays a crucial role in the biosynthesis of complex lipids. Notably, it can efficiently phosphorylate 1-alkyl-2-acylglycerol in vitro, particularly if it contains an arachidonoyl group, showcasing its versatility. Moreover, DGKA is involved in the production of alkyl-lysophosphatidic acid, another bioactive lipid, achieved through the phosphorylation of 1-alkyl-2-acetyl glycerol. These multifaceted roles highlight DGKA's significance in lipid metabolism and its regulatory impact on diverse cellular pathways.

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Human

Sf9 insect cells

C-Myc;N-10*His

P23743-1 (M1-S735)

1606

Full Length of Isoform-1

MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.