1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Lipid Kinase
  4. diacylglycerol kinase
  5. DGKA
  6. DGKA Protein, Human (sf9, His, Myc)

The DGKA protein converts diacylglycerol (DAG) into phosphatidic acid (PA), regulates its levels and serves as a central switch between signaling pathways. DGKA Protein, Human (sf9, His, Myc) is the recombinant human-derived DGKA, expressed by Sf9 insect cells, with C-Myc, N-10*His labeled tag. The total length of DGKA Protein, Human (sf9, His, Myc) is 735 a.a..

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The DGKA protein converts diacylglycerol (DAG) into phosphatidic acid (PA), regulates its levels and serves as a central switch between signaling pathways. DGKA Protein, Human (sf9, His, Myc) is the recombinant human-derived DGKA, expressed by Sf9 insect cells, with C-Myc, N-10*His labeled tag. The total length of DGKA Protein, Human (sf9, His, Myc) is 735 a.a..

Background

The DGKA protein functions as a diacylglycerol kinase, catalyzing the conversion of diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and intricately regulating the levels of these two bioactive lipids. This enzymatic activity positions DGKA as a central switch governing the signaling pathways activated by these second messengers, each exerting distinct effects in numerous biological processes. Additionally, DGKA plays a crucial role in the biosynthesis of complex lipids. Notably, it can efficiently phosphorylate 1-alkyl-2-acylglycerol in vitro, particularly if it contains an arachidonoyl group, showcasing its versatility. Moreover, DGKA is involved in the production of alkyl-lysophosphatidic acid, another bioactive lipid, achieved through the phosphorylation of 1-alkyl-2-acetyl glycerol. These multifaceted roles highlight DGKA's significance in lipid metabolism and its regulatory impact on diverse cellular pathways.

Biological Activity

The kinase activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

Sf9 insect cells

Tag

C-Myc;N-10*His

Accession

P23743-1 (M1-S735)

Gene ID

1606

Protein Length

Full Length of Isoform-1

Synonyms
80 kDa diacylGlycerol kinase; DAG kinase alpha; DAGK; DAGK1; DGK alpha; DGK-alpha; dgkA; DGKA_HUMAN; DiacylGlycerol kinase alpha; DiacylGlycerol kinase; alpha 80kDa; Diglyceride kinase alpha; MGC12821; MGC42356; OTTHUMP00000242836; OTTHUMP00000242955; OTTHUMP00000244046
AA Sequence

MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS

Predicted Molecular Mass
86.7 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DGKA Protein, Human (sf9, His, Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

DGKA Protein, Human (sf9, His, Myc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DGKA Protein, Human (sf9, His, Myc)
Cat. No.:
HY-P702617
Quantity:
MCE Japan Authorized Agent: