DHRS9 Protein, Human (His)
DHRS9 Protein, a 3-alpha-hydroxysteroid dehydrogenase, converts 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone, supported by studies. Additionally, DHRS9 significantly contributes to retinoic acid biosynthesis from retinaldehyde, utilizing both NADH and NADPH as coenzymes in its reactions. DHRS9 Protein, Human (His) is the recombinant human-derived DHRS9 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DHRS9 Protein, a 3-alpha-hydroxysteroid dehydrogenase, converts 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone, supported by studies. Additionally, DHRS9 significantly contributes to retinoic acid biosynthesis from retinaldehyde, utilizing both NADH and NADPH as coenzymes in its reactions. DHRS9 Protein, Human (His) is the recombinant human-derived DHRS9 protein, expressed by E. coli , with N-His labeled tag.
Background
The DHRS9 protein is a 3-alpha-hydroxysteroid dehydrogenase that performs the conversion of 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. This enzymatic activity has been supported by studies. Furthermore, DHRS9 also plays a significant role in the biosynthesis of retinoic acid from retinaldehyde, as evidenced by research. Notably, this protein has the ability to utilize both NADH and NADPH as coenzymes in its enzymatic reactions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9BPW9 (R18-V319)
-
Molecular Construction
-
N-term
-
His
-
DHRS9 (R18-V319)
Accession # Q9BPW9 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DHRS9; Dehydrogenase/Reductase (SDR Family) Member 9; Dehydrogenase/Reductase 9; Dehydrogenase/Reductase SDR Family Member 9; SDR9C4; Short-Chain Dehydrogenase/Reductase RetSDR8; RDH15; Retinol Dehydrogenase Homolog; RDHL; Retinol Dehydrogenase 15; NADP-D
-
AA Sequence
RKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV
-
Predicted Molecular Mass
35.5 kDa
-
Molecular Weight
Approximately 34 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
