1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. DHRS9 Protein, Human (His)

DHRS9 Protein, a 3-alpha-hydroxysteroid dehydrogenase, converts 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone, supported by studies. Additionally, DHRS9 significantly contributes to retinoic acid biosynthesis from retinaldehyde, utilizing both NADH and NADPH as coenzymes in its reactions. DHRS9 Protein, Human (His) is the recombinant human-derived DHRS9 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DHRS9 Protein, a 3-alpha-hydroxysteroid dehydrogenase, converts 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone, supported by studies. Additionally, DHRS9 significantly contributes to retinoic acid biosynthesis from retinaldehyde, utilizing both NADH and NADPH as coenzymes in its reactions. DHRS9 Protein, Human (His) is the recombinant human-derived DHRS9 protein, expressed by E. coli , with N-His labeled tag.

Background

The DHRS9 protein is a 3-alpha-hydroxysteroid dehydrogenase that performs the conversion of 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. This enzymatic activity has been supported by studies. Furthermore, DHRS9 also plays a significant role in the biosynthesis of retinoic acid from retinaldehyde, as evidenced by research. Notably, this protein has the ability to utilize both NADH and NADPH as coenzymes in its enzymatic reactions.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9BPW9 (R18-V319)

Gene ID
Molecular Construction
N-term
His
DHRS9 (R18-V319)
Accession # Q9BPW9
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Dehydrogenase/reductase SDR family member 9; 3-alpha-HSD; RDH-E2; RDH15; SDR9C4
AA Sequence

RKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALKAETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFGLISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTHYAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV

Predicted Molecular Mass
35.5 kDa
Molecular Weight

Approximately 34 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

DHRS9 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

DHRS9 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DHRS9 Protein, Human (His)
Cat. No.:
HY-P76871
Quantity:
MCE Japan Authorized Agent: