DPEP2 Protein, Human (HEK293, Fc)
The DPEP2 protein functions as a dipeptidase capable of hydrolyzing leukotriene D4 (LTD4) into leukotriene E4 (LTE4) and cysteinyl diglycine. In addition to its dipeptidase activity, DPEP2 serves as a modulator of macrophage inflammatory responses by acting as a modulator of the NF-kappaB inflammatory signaling pathway. DPEP2 Protein, Human (HEK293, Fc) is the recombinant human-derived DPEP2 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The DPEP2 protein functions as a dipeptidase capable of hydrolyzing leukotriene D4 (LTD4) into leukotriene E4 (LTE4) and cysteinyl diglycine. In addition to its dipeptidase activity, DPEP2 serves as a modulator of macrophage inflammatory responses by acting as a modulator of the NF-kappaB inflammatory signaling pathway. DPEP2 Protein, Human (HEK293, Fc) is the recombinant human-derived DPEP2 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
DPEP2 (Dipeptidase 2) is a versatile protein with dipeptidase activity, exhibiting the ability to hydrolyze leukotriene D4 (LTD4) into leukotriene E4 (LTE4), as well as cleave cystinyl-bis-glycine. Beyond its enzymatic functions, DPEP2 possesses an independent role in modulating macrophage inflammatory responses by acting as a regulator of the NF-kappaB inflammatory signaling pathway. This dual functionality suggests that DPEP2 plays a multifaceted role in cellular processes, participating both in the metabolism of bioactive lipids and in the regulation of key inflammatory pathways, showcasing its importance in immune and inflammatory responses.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
AAH24021.1 (A33-S376)
-
Molecular Construction
-
N-term
-
DPEP2 (A33-S376)
Accession # AAH24021.1 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
DPEP2; Dipeptidase; Dipeptidase 2; MBD2
-
AA Sequence
AYTTPGPPRAQFWSAYVPCQTQDRDALRLTLEQIDLIRRMCASYSELELVTSAKALNDTQKLACLIGVEGGHSLDNSLSILRTFYMLGVRYLTLTHTCNTPWAESSAKGVHSFYNNISGLTDFGEKVVAEMNRLGMMVDLSHVSDAVARRALEVSQAPVIFSHSAARGVCNSARNVPDDILQLLKKNGGVVMVSLSMGVIQCNPSANVSTVADHFDHIKAVIGSKFIGIGGDYDGAGKFPQGLEDVSTYPVLIEELLSRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSVS
-
Predicted Molecular Mass
65 kDa
-
Molecular Weight
Approximately 72 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
