ECSCR Protein, Human (HEK293, Fc)
ECSCR Protein plays a crucial role in regulating endothelial chemotaxis and tube formation, emphasizing its significance in angiogenesis. Additionally, it contributes to apoptosis by modulating the actin cytoskeleton and facilitating the proteasomal degradation of apoptosis inhibitors BIRC3/IAP1 and BIRC2/IAP2. ECSCR Protein interacts with FLNA and the 20S proteasome subunit PSMA7, indicating its involvement in multiple cellular processes. ECSCR Protein, Human (HEK293, Fc) is the recombinant human-derived ECSCR protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ECSCR Protein plays a crucial role in regulating endothelial chemotaxis and tube formation, emphasizing its significance in angiogenesis. Additionally, it contributes to apoptosis by modulating the actin cytoskeleton and facilitating the proteasomal degradation of apoptosis inhibitors BIRC3/IAP1 and BIRC2/IAP2. ECSCR Protein interacts with FLNA and the 20S proteasome subunit PSMA7, indicating its involvement in multiple cellular processes. ECSCR Protein, Human (HEK293, Fc) is the recombinant human-derived ECSCR protein, expressed by HEK293 , with C-hFc labeled tag.
Background
ECSCR Protein plays a crucial role in regulating endothelial chemotaxis and tube formation, highlighting its significance in angiogenesis. It also contributes to apoptosis by modulating the actin cytoskeleton and facilitating the proteasomal degradation of apoptosis inhibitors BIRC3/IAP1 and BIRC2/IAP2. ECSCR Protein interacts with FLNA and the 20S proteasome subunit PSMA7, suggesting its involvement in multiple cellular processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q19T08 (Q25-A124)
-
Molecular Construction
-
N-term
-
ECSCR (Q25-A124)
Accession # Q19T08 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ECSCR; Apoptosis Regulator Through Modulating IAP Expression; Endothelial Cell Surface Expressed Chemotaxis And Apoptosis Regulator; Endothelial Cell-Specific Chemotaxis Regulator; ECSM2; Endothelial Cell-Specific Molecule 2; ARIA
-
AA Sequence
QPTMTQTSSSQGGLGGLSLTTEPVSSNPGYIPSSEANRPSHLSSTGTPGAGVPSSGRDGGTSRDTFQTVPPNSTTMSLSMREDATILPSPTSETVLTVAA
-
Predicted Molecular Mass
36.8 kDa
-
Molecular Weight
Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
