ECSCR Protein, Mouse (HEK293, Fc)
ECSCR proteins are critical in angiogenesis, regulating endothelial chemotaxis, and tube formation. It regulates apoptosis by affecting the actin cytoskeleton and promoting proteasomal degradation of apoptosis inhibitors. ECSCR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived ECSCR protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ECSCR proteins are critical in angiogenesis, regulating endothelial chemotaxis, and tube formation. It regulates apoptosis by affecting the actin cytoskeleton and promoting proteasomal degradation of apoptosis inhibitors. ECSCR Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived ECSCR protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The ECSCR protein plays a crucial role in regulating endothelial chemotaxis and tube formation, emphasizing its significance in angiogenesis (By similarity). Additionally, ECSCR contributes to apoptosis modulation by influencing the actin cytoskeleton and facilitating the proteasomal degradation of apoptosis inhibitors BIRC3/IAP1 and BIRC2/IAP2. These interactions underscore ECSCR's multifaceted involvement in cellular processes, influencing both angiogenesis and apoptosis. Furthermore, ECSCR interacts with FLNA, suggesting a potential link to the actin cytoskeleton dynamics, and with the 20S proteasome subunit PSMA7, indicating its participation in proteasomal degradation processes. These diverse molecular interactions highlight the central role of ECSCR in orchestrating complex cellular events that impact vascular development and cell survival mechanisms.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
Q3TZW0-1 (Q19-T130)
-
Molecular Construction
-
N-term
-
ECSCR (Q19-T130)
Accession # Q3TZW0-1 -
hFc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ECSCR; Apoptosis Regulator Through Modulating IAP Expression; Endothelial Cell Surface Expressed Chemotaxis And Apoptosis Regulator; Endothelial Cell-Specific Chemotaxis Regulator; ECSM2; Endothelial Cell-Specific Molecule 2; ARIA
-
AA Sequence
QPTTTQTSQEILQKSSQVSLVSNQPVTPRSSTMDKQSLSLPDLMSFQPQKHTLGPGTGTPERSSSSSSSSSSRRGEASLDATPSPETTSLQTKKMTILLTILPTPTSESVLT
-
Predicted Molecular Mass
38.6 kDa
-
Molecular Weight
Approximately 48-68 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
