EEF1B2 Protein, Human (His)
Based on 1 Customer Validation
EEF1B2 Protein facilitates GDP-to-GTP exchange on EEF1A Protein, driving the conversion. EEF1 comprises four subunits: alpha, beta, delta, and gamma. EEF1B2 Protein, Human (His) is the recombinant human-derived EEF1B2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
EEF1B2 Protein facilitates GDP-to-GTP exchange on EEF1A Protein, driving the conversion. EEF1 comprises four subunits: alpha, beta, delta, and gamma. EEF1B2 Protein, Human (His) is the recombinant human-derived EEF1B2 protein, expressed by E. coli , with N-6*His labeled tag.
Background
EEF1B2 Protein catalyzes the exchange of GDP bound to EEF1A Protein, promoting the conversion to GTP. EEF1 consists of four subunits: alpha, beta, delta, and gamma.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P24534 (G2-I225)
-
Molecular Construction
-
N-term
-
6*His
-
EEF1B2 (G2-I225)
Accession # P24534 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
EEF1B2; EEF1B; Eukaryotic Translation Elongation Factor 1 Beta 2; EF1B; Elongation Factor 1-Beta; Eukaryotic Translation Elongation Factor 1 Beta 1; EEF-1B Alpha; EEF1B1; EF-1-Beta
-
AA Sequence
GFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI
-
Predicted Molecular Mass
25 kDa
-
Molecular Weight
Approximately 29 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 300 mM NaCl, pH 7.4, 5% trehalose, 5% mannitol and 0.01% Tween 80.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)