EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi)

The EpCAM/TROP1 protein serves as an important homogeneous interacting molecule that promotes direct contact between intestinal epithelial cells (IEC) and intraepithelial lymphocytes (IEL) in the mucosal epithelium. This feature helps establish an immune barrier against mucosal infections. EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

The EpCAM/TROP1 Protein emerges as a pivotal entity, potentially functioning as a physical homophilic interaction molecule that fosters direct contact between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium, thereby contributing to the establishment of an immunological barrier as the primary defense against mucosal infections. Beyond its role in mucosal immunity, this protein plays a significant part in the proliferation and differentiation of embryonic stem cells. It further exhibits regulatory influence by up-regulating the expression of FABP5, MYC, and cyclins A and E, implicating EpCAM/TROP1 in the modulation of key cellular processes. Its monomeric nature and interaction with phosphorylated CLDN7 underscore the intricate molecular interactions involved, providing insights into the diverse functions of this protein in cellular physiology.

1. Human EpCAM immobilized on CM5 Chip can bind AG-2 (HY-P7465A) with an affinity constant of 0.272 nM as determined in a SPR assay.
2. Loaded EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi) on HIS1K biosensor, can bind Tucotuzumab (HY-P99328) with an affinity constant of 3.827E-11 M as determined in BLI assay.

• 
  Human EpCAM immobilized on CM5 Chip can bind AG-2 (HY-P7465A) with an affinity constant of 0.272 nM as determined in a SPR assay.
• 
  Loaded EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi) on HIS1K biosensor, can bind Tucotuzumab (HY-P99328) with an affinity constant of 3.827E-11 M as determined in BLI assay.

Human

HEK293

C-Avi;C-6*His

AAH14785.1 (Q24-K265)

4072  [NCBI]

Partial

Biotin

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

35-50 kDa

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.