Copy Link Print Information

EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

The EpCAM/TROP1 protein serves as an important homogeneous interacting molecule that promotes direct contact between intestinal epithelial cells (IEC) and intraepithelial lymphocytes (IEL) in the mucosal epithelium. This feature helps establish an immune barrier against mucosal infections. EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi)
  • Experimental Validation Results for EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi)
  • EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The EpCAM/TROP1 protein serves as an important homogeneous interacting molecule that promotes direct contact between intestinal epithelial cells (IEC) and intraepithelial lymphocytes (IEL) in the mucosal epithelium. This feature helps establish an immune barrier against mucosal infections. EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived EpCAM/TROP1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Background

The EpCAM/TROP1 Protein emerges as a pivotal entity, potentially functioning as a physical homophilic interaction molecule that fosters direct contact between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium, thereby contributing to the establishment of an immunological barrier as the primary defense against mucosal infections. Beyond its role in mucosal immunity, this protein plays a significant part in the proliferation and differentiation of embryonic stem cells. It further exhibits regulatory influence by up-regulating the expression of FABP5, MYC, and cyclins A and E, implicating EpCAM/TROP1 in the modulation of key cellular processes. Its monomeric nature and interaction with phosphorylated CLDN7 underscore the intricate molecular interactions involved, providing insights into the diverse functions of this protein in cellular physiology.

Verified Bioactivity

1. Human EpCAM immobilized on CM5 Chip can bind AG-2 (HY-P7465A) with an affinity constant of 0.272 nM as determined in a SPR assay.
2. Loaded EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi) on HIS1K biosensor, can bind Tucotuzumab (HY-P99328) with an affinity constant of 3.827E-11 M as determined in BLI assay.

MCE Validation Data

  • Bioactivity - SPR

    Bioactivity - SPR

    Human EpCAM immobilized on CM5 Chip can bind AG-2 (HY-P7465A) with an affinity constant of 0.272 nM as determined in a SPR assay.

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi) on HIS1K biosensor, can bind Tucotuzumab (HY-P99328) with an affinity constant of 3.827E-11 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Avi;C-6*His
  • Accession

    AAH14785.1 (Q24-K265)

  • Gene ID
    4072  [NCBI]
  • Molecular Construction
    • N-term
    • EpCAM (Q24-K265)
      Accession # AAH14785.1
    • 6*His-Avi
    • C-term
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    EPCAM; HEA125; Prev. TACSTD1; CO-17A; Prev. MIC18; EGP314; Prev. M4S1; EGP34; Tumor-Associated Calcium Signal Transducer 1; CD326; TROP1; MOC31; KSA; 17-1A; GA733-2; Ly74; Ber-Ep4; MH99; Ep-CAM; Membrane Component, Chromosome 4, Surface Marker (35kD Glyco

  • AA Sequence

    QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLK

  • Predicted Molecular Mass

    30.2 kDa

  • Molecular Weight

    Approximately 34-50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Human EpCAM immobilized on CM5 Chip can bind AG-2 (HY-P7465A) with an affinity constant of 0.272 nM as determined in a SPR assay.

  • 1/16

    MedChemExpress Validation
     Loaded EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi) on HIS1K biosensor, can bind Tucotuzumab (HY-P99328) with an affinity constant of 3.827E-11 M as determined in BLI assay.

  • EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi) Product Image
    1/16
  • Experimental Validation Results for EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi)
  • Experimental Validation Results for EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi)
  • EpCAM/TROP1 Protein, Human (Biotinylated, HEK293, His-Avi) Product Image