EPHA10 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

EphA10, a receptor for ephrin-A family members, selectively binds EFNA3, EFNA4, and EFNA5, indicating its involvement in mediating cellular responses to ephrin-A ligands and participating in diverse cellular processes regulated by Eph-ephrin signaling pathways. EPHA10 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EPHA10 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

EphA10, a receptor for ephrin-A family members, selectively binds EFNA3, EFNA4, and EFNA5, indicating its involvement in mediating cellular responses to ephrin-A ligands and participating in diverse cellular processes regulated by Eph-ephrin signaling pathways. EPHA10 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EPHA10 protein, expressed by HEK293 , with C-His labeled tag.

Background

EphA10, identified as a receptor for members of the ephrin-A family, plays a crucial role in cellular signaling. Specifically, it acts as a receptor for ephrin ligands EFNA3, EFNA4, and EFNA5. The interaction between EphA10 and these ephrin-A family members suggests its involvement in diverse cellular processes, likely including cell-cell communication and regulation of tissue development. This receptor-ligand binding capacity highlights EphA10's significance in mediating signaling events that contribute to various physiological and developmental processes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Cynomolgus EPHA10 is coated at 5 μg/mL (100 μL/well) can bind Human Ephrin-A3. The ED50 for this effect is 1.106 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Cynomolgus EPHA10 is coated at 5 μg/mL (100 μL/well) can bind Human Ephrin-A3. The ED50 for this effect is 1.106 ng/mL.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • EPHA10 (E34-A565)
      Accession # XP_045230088.1
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    EPHA10; FLJ33655; EPH Receptor A10; EphA10s Protein; Ephrin Type-A Receptor 10; EPHA10 Protein; FLJ16103; DFNA88

  • AA Sequence

    EEVILLDSKASQAELGWTALPSNGWEEISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWISRGRGQRIFVELQFTLRDCSSIPGAAGTCKETFNVYYLETEADLGRGRPRLGGSRPRKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSRRGFHLAFQDVGACVALVSVRVYYKQCRATVRGLAAFPATAAESAFSTLVEVAGTCVAHSEGEPGSPPRMHCGADGEWLVPVGRCSCSAGFQERGDICEACPPGFYKVSPRRPLCSPCPEHSRALENASTFCVCQDSYARSPTDPPSASCTRPPSAPRDLQYSLSRSPLALRLRWLPPADSGGRSDVTYSLLCLRCGREGPAGACEPCGPRVAFVPRQAGLRERAATLLHLRPGARYTVRVAALNGVSGPAAAAGATYAQVTVSTGPGAPWEEDEIRRERVEPQSVSLSWREPIPAGAPGANGTEYEIRYYEKGQSEQTYSMVKTGAPTVTVTNLKPATRYVFQIRAASPGPSWEAQSFNPSIEVQTPGEAASGSRDQSPA

  • Molecular Weight

    Approximately 68-78 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 8.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00