Ephrin-A4/EFNA4 Protein, Human (HEK293, His)
Ephrin-A4/EFNA4 Protein, a GPI-bound ligand, interacts with Eph receptors, crucial for neuronal, vascular, and epithelial development. It enables migration, repulsion, and adhesion by binding to neighboring Eph receptors, initiating bidirectional signaling. Furthermore, it potentially facilitates the interaction between activated B-lymphocytes and dendritic cells in tonsils. Ephrin-A4/EFNA4 Protein, Human (HEK293, His) is the recombinant human-derived Ephrin-A4/EFNA4 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Ephrin-A4/EFNA4 Protein, a GPI-bound ligand, interacts with Eph receptors, crucial for neuronal, vascular, and epithelial development. It enables migration, repulsion, and adhesion by binding to neighboring Eph receptors, initiating bidirectional signaling. Furthermore, it potentially facilitates the interaction between activated B-lymphocytes and dendritic cells in tonsils. Ephrin-A4/EFNA4 Protein, Human (HEK293, His) is the recombinant human-derived Ephrin-A4/EFNA4 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Ephrin-A4/EFNA4 Protein is a cell surface GPI-bound ligand that interacts with Eph receptors, a family of receptor tyrosine kinases essential for neuronal, vascular, and epithelial development, enabling migration, repulsion, and adhesion. It binds promiscuously to Eph receptors on neighboring cells, initiating contact-dependent bidirectional signaling. Additionally, Ephrin-A4/EFNA4 Protein may contribute to the interaction between activated B-lymphocytes and dendritic cells in tonsils.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P52798 (L26-G171)
-
Molecular Construction
-
N-term
-
EFNA4 (L26-G171)
Accession # P52798 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
EFNA4; Ephrin-A4; Prev. EPLG4; Ligand Of Eph-Related Kinase 4; LERK4; EFL4; EPH-Related Receptor Tyrosine Kinase Ligand 4; Ephrin A4; LERK-4
-
AA Sequence
LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG
-
Predicted Molecular Mass
17.4 kDa
-
Molecular Weight
Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
