Ephrin-B1/EFNB1 Protein, Human (HEK293, His)
Ephrin-B1/EFNB1 Protein, a transmembrane ligand, interacts with Eph receptors, facilitating bidirectional signaling. It binds EPHB1/ELK and EPHB2/3, inducing axon collapse and growth cone orientation. EFNB1 also interacts with GRIP1/2, TLE1, and enhances ZHX2's transcriptional repression activity. These interactions highlight EFNB1's role in diverse developmental processes. Ephrin-B1/EFNB1 Protein, Human (HEK293, His) is the recombinant human-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Ephrin-B1/EFNB1 Protein, a transmembrane ligand, interacts with Eph receptors, facilitating bidirectional signaling. It binds EPHB1/ELK and EPHB2/3, inducing axon collapse and growth cone orientation. EFNB1 also interacts with GRIP1/2, TLE1, and enhances ZHX2's transcriptional repression activity. These interactions highlight EFNB1's role in diverse developmental processes. Ephrin-B1/EFNB1 Protein, Human (HEK293, His) is the recombinant human-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Ephrin-B1/EFNB1 Protein is a cell surface transmembrane ligand that interacts with Eph receptors, a family of receptor tyrosine kinases, crucial for neuronal, vascular, and epithelial development. This binding leads to contact-dependent bidirectional signaling between neighboring cells. Ephrin-B1/EFNB1 shows high affinity for the receptor tyrosine kinase EPHB1/ELK and can also bind EPHB2 and EPHB3. In vitro studies demonstrate that it can induce the collapse of commissural axons and growth cones, suggesting a role in orienting longitudinally projecting axons. Ephrin-B1/EFNB1 interacts with GRIP1 and GRIP2 through its PDZ-binding motif and with TLE1. Additionally, the intracellular domain peptide of Ephrin-B1/EFNB1 interacts with ZHX2, enhancing ZHX2's transcriptional repression activity.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P98172 (L28-G232)
-
Molecular Construction
-
N-term
-
EFNB1 (L28-G232)
Accession # P98172 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
EFNB1; ELK Ligand; Prev. EPLG2; Craniofrontonasal Syndrome (Craniofrontonasal Dysplasia); Prev. CFNS; LERK-2; LERK2; ELK-L; EPH-Related Receptor Tyrosine Kinase Ligand 2; EFL-3; Ephrin-B1; CFND; Elk-L; EFB1; Ephrin B1; EFL3
-
AA Sequence
LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDG
-
Predicted Molecular Mass
23.4 kDa
-
Molecular Weight
Approximately 28-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)