ESAM Protein, Human (HEK293, His)
Based on 1 Customer Validation
ESAM, short for Endothelial Cell Selective Adhesion Molecule, has the ability to induce aggregation, possibly through homophilic molecular interactions. It plays a role in molecular communication by binding to MAGI1, possibly forming complexes that contribute to intercellular signaling and adhesion processes. ESAM Protein, Human (HEK293, His) is the recombinant human-derived ESAM protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
ESAM, short for Endothelial Cell Selective Adhesion Molecule, has the ability to induce aggregation, possibly through homophilic molecular interactions. It plays a role in molecular communication by binding to MAGI1, possibly forming complexes that contribute to intercellular signaling and adhesion processes. ESAM Protein, Human (HEK293, His) is the recombinant human-derived ESAM protein, expressed by HEK293 , with C-6*His labeled tag.
Background
ESAM, short for Endothelial cell-selective adhesion molecule, possesses the ability to induce aggregation, likely through a homophilic molecular interaction. It plays a role in molecular communication by engaging with MAGI1, potentially forming a complex that contributes to intercellular signaling and adhesion processes. Further investigation is necessary to elucidate the precise mechanisms and functions of ESAM and its interactions with MAGI1 in different physiological and pathological contexts.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q96AP7-1 (Q30-A247 )
-
Molecular Construction
-
N-term
-
ESAM (Q30-A247 )
Accession # Q96AP7-1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
ESAM; HUEL (C4orf1)-Interacting Protein; Endothelial Cell Adhesion Molecule; LP4791 Protein; Endothelial Cell-Selective Adhesion Molecule; 2310008D05Rik; W117m; NEDIHSS
-
AA Sequence
QLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGA
-
Predicted Molecular Mass
24.8 kDa
-
Molecular Weight
Approximately 38 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
