FBXO48 Protein, Human (His, Myc)

Customer Review

Based on 1 Customer Validation

The FBXO48 Protein is part of the SCF ubiquitin ligase complex and participates in the catabolism of SCF-dependent proteasome ubiquitin-dependent proteins. The FBXO48 Protein undergoes polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampk伪 (PAMPK-伪). FBXO48 Protein, Human (His) is the recombinant human-derived FBXO48 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The FBXO48 Protein is part of the SCF ubiquitin ligase complex and participates in the catabolism of SCF-dependent proteasome ubiquitin-dependent proteins. The FBXO48 Protein undergoes polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampk伪 (PAMPK-伪). FBXO48 Protein, Human (His) is the recombinant human-derived FBXO48 protein, expressed by E. coli , with N-His, C-Myc labeled tag.

Background

F-box only protein 48 is part of the SCF ubiquitin ligase complex and is involved in the catabolic process of SCF-dependent proteasome ubiquitin-dependent proteins. FBXO48 performs polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampkα (PAMPK-α). FBXO48 gene is located at the pathogenic gene locus 2p13.3 of Parkinson's disease type 3 (PARK3) and is one of the homologous genes of the pathogenic gene F-box only protein 7 gene (FBXO7) of Parkinson's disease type 15 (PARK15). Also known as Parkinsonian pyramidopathy (PPD)[1][2][3].

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His;C-Myc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • FBXO48 (M1-R155)
      Accession # Q5FWF7
    • Myc
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    FBXO48; F-Box Only Protein 48; F-Box Protein 48; FBX48

  • AA Sequence

    MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPMDADTWGEILEAELER

  • Predicted Molecular Mass

    25.7 kDa

  • Molecular Weight

    Approximately 30 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00