FBXO48 Protein, Human (His, Myc)
Based on 1 Customer Validation
The FBXO48 Protein is part of the SCF ubiquitin ligase complex and participates in the catabolism of SCF-dependent proteasome ubiquitin-dependent proteins. The FBXO48 Protein undergoes polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampk伪 (PAMPK-伪). FBXO48 Protein, Human (His) is the recombinant human-derived FBXO48 protein, expressed by E. coli , with N-His, C-Myc labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FBXO48 Protein is part of the SCF ubiquitin ligase complex and participates in the catabolism of SCF-dependent proteasome ubiquitin-dependent proteins. The FBXO48 Protein undergoes polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampk伪 (PAMPK-伪). FBXO48 Protein, Human (His) is the recombinant human-derived FBXO48 protein, expressed by E. coli , with N-His, C-Myc labeled tag.
Background
F-box only protein 48 is part of the SCF ubiquitin ligase complex and is involved in the catabolic process of SCF-dependent proteasome ubiquitin-dependent proteins. FBXO48 performs polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampkα (PAMPK-α). FBXO48 gene is located at the pathogenic gene locus 2p13.3 of Parkinson's disease type 3 (PARK3) and is one of the homologous genes of the pathogenic gene F-box only protein 7 gene (FBXO7) of Parkinson's disease type 15 (PARK15). Also known as Parkinsonian pyramidopathy (PPD)[1][2][3].
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His;C-Myc
-
Accession
Q5FWF7 (M1-R155)
-
Gene ID554251 [NCBI]
-
Molecular Construction
-
N-term
-
10*His
-
FBXO48 (M1-R155)
Accession # Q5FWF7 -
Myc
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
FBXO48; F-Box Only Protein 48; F-Box Protein 48; FBX48
-
AA Sequence
MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPMDADTWGEILEAELER
-
Predicted Molecular Mass
25.7 kDa
-
Molecular Weight
Approximately 30 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
