FBXO48 Protein, Human (His)

The FBXO48 Protein is part of the SCF ubiquitin ligase complex and participates in the catabolism of SCF-dependent proteasome ubiquitin-dependent proteins. The FBXO48 Protein undergoes polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampk伪 (PAMPK-伪). FBXO48 Protein, Human (His) is the recombinant human-derived FBXO48 protein, expressed by E. coli , with N-His, C-Myc labeled tag. The total length of FBXO48 Protein, Human (His) is 155 a.a., with molecular weight of ~25.7 kDa.

F-box only protein 48 is part of the SCF ubiquitin ligase complex and is involved in the catabolic process of SCF-dependent proteasome ubiquitin-dependent proteins. FBXO48 performs polyubiquitination and proteasome degradation by targeting activity-phosphorylated Ampkα (PAMPK-α). FBXO48 gene is located at the pathogenic gene locus 2p13.3 of Parkinson's disease type 3 (PARK3) and is one of the homologous genes of the pathogenic gene F-box only protein 7 gene (FBXO7) of Parkinson's disease type 15 (PARK15). Also known as Parkinsonian pyramidopathy (PPD)^[1][2][3].

Human

E. coli

N-His;C-Myc

Q5FWF7 (1M-155R)

554251  [NCBI]

MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPMDADTWGEILEAELER

Approximately 25.7 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.