Fc gamma RIIA/CD32a Protein, Human (CHO, His)
Fc gamma The RIIA/CD32a protein plays a key role as a low-affinity receptor that specifically binds to the Fc region of immunoglobulin gamma. It interacts with IgG to initiate cellular responses against pathogens, which is critical for immune regulation. Fc gamma RIIA/CD32a Protein, Human (CHO, His) is the recombinant human-derived Fc gamma RIIA/CD32a protein, expressed by CHO , with C-His labeled tag.
- Species: Human
- Source: CHO
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Fc gamma The RIIA/CD32a protein plays a key role as a low-affinity receptor that specifically binds to the Fc region of immunoglobulin gamma. It interacts with IgG to initiate cellular responses against pathogens, which is critical for immune regulation. Fc gamma RIIA/CD32a Protein, Human (CHO, His) is the recombinant human-derived Fc gamma RIIA/CD32a protein, expressed by CHO , with C-His labeled tag.
Background
The Fc gamma RIIA/CD32a protein assumes a pivotal role by specifically binding to the Fc region of immunoglobulins gamma, functioning as a low-affinity receptor. Through its interaction with IgG, Fc gamma RIIA/CD32a initiates cellular responses against pathogens and soluble antigens, illustrating its crucial involvement in immune modulation. Notably, the protein promotes the phagocytosis of opsonized antigens, further contributing to immune defense mechanisms. Additionally, Fc gamma RIIA/CD32a engages in interactions with IGHG1, INPP5D/SHIP1, INPPL1/SHIP2, APCS, FGR, and HCK, indicating its participation in intricate signaling pathways and the regulation of its cellular functions. These multifaceted interactions underscore the significance of Fc gamma RIIA/CD32a in orchestrating diverse immune responses.
Technical Parameters
-
Species Human
-
Source CHO
-
Tag C-His
-
Accession
P12318-1 (Q34-I218, H167)
-
Molecular Construction
-
N-term
-
CD32a (Q34-I218, H167)
Accession # P12318-1 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
FCGR2A; Fc Fragment Of IgG, Low Affinity IIa, Receptor (CD32); Prev. FCGR2A1; Fc Fragment Of IgG Receptor IIa; Prev. FCG2; IgG Fc Receptor II-A; Prev. FCGR2; FcRII-A; Fc-Gamma-RIIa; Fc Fragment Of IgG, Low Affinity IIa, Receptor For (CD32); IGFR2; Fc Gamm
-
AA Sequence
QAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
-
Predicted Molecular Mass
22 kDa
-
Molecular Weight
Approximately 29-32 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
