Fc gamma RIIIA/CD16a Protein, Human (CHO, His)
Fc gamma RIIIA/CD16a protein is a receptor for the Fc fragment of IgG and activates antibody-dependent cellular cytotoxicity (ADCC) upon binding to antigen-IgG complexes. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells to efficiently eliminate virally infected cells. Fc gamma RIIIA/CD16a Protein, Human (CHO, His) is the recombinant human-derived Fc gamma RIIIA/CD16a protein, expressed by CHO , with C-His labeled tag.
- Species: Human
- Source: CHO
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
Fc gamma RIIIA/CD16a protein is a receptor for the Fc fragment of IgG and activates antibody-dependent cellular cytotoxicity (ADCC) upon binding to antigen-IgG complexes. It mediates IgG effector functions on NK cells, generating memory-like adaptive NK cells to efficiently eliminate virally infected cells. Fc gamma RIIIA/CD16a Protein, Human (CHO, His) is the recombinant human-derived Fc gamma RIIIA/CD16a protein, expressed by CHO , with C-His labeled tag.
Background
Fc gamma RIIIA/CD16a Protein serves as a receptor for the invariable Fc fragment of immunoglobulin gamma (IgG), optimally activated upon binding clustered antigen-IgG complexes displayed on cell surfaces, initiating antibody-dependent cellular cytotoxicity (ADCC). This process involves the lysis of antibody-coated cells, preventing inappropriate effector cell activation in the absence of an antigenic trigger. The protein mediates IgG effector functions on natural killer (NK) cells, binding antigen-IgG complexes generated during infection to trigger NK cell-dependent cytokine production and degranulation. Fc gamma RIIIA/CD16a is crucial in generating memory-like adaptive NK cells that efficiently eliminate virus-infected cells via ADCC. It regulates NK cell survival, proliferation, and prevents NK cell progenitor apoptosis. As an Fc-binding subunit, it associates with CD247 and/or FCER1G adapters to form functional signaling complexes, leading to intracellular signaling cascades that drive NK cell activation. The protein also plays a role in mediating the antitumor activities of therapeutic antibodies, triggering TNFA-dependent ADCC of IgG-coated tumor cells and enhancing ADCC in response to afucosylated IgGs. In the context of Dengue virus infection, Fc gamma RIIIA/CD16a is involved in pathogenesis through an antibody-dependent enhancement (ADE) mechanism, facilitating virus entry into myeloid cells and subsequent viral replication during secondary infections.
Technical Parameters
-
Species Human
-
Source CHO
-
Tag C-His
-
Accession
P08637 (G17-Q208)
-
Molecular Construction
-
N-term
-
CD16a (G17-Q208)
Accession # P08637 -
His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
FCGR3A; CD16; Prev. FCGR3; Fc Fragment Of IgG, Low Affinity IIIa, Receptor For (CD16); Prev. FCG3; Fc Of IgG Low Affinity IIIa Receptor Isoform 2; FcgammaRIIIa; Fc Of IgG Low Affinity IIIa Receptor Isoform 1; FcGRIIIA; Immunoglobulin G Fc Receptor III; CD
-
AA Sequence
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
-
Predicted Molecular Mass
23.3 kDa
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)