FGF-19 Protein, Human (HEK293, Fc)
FGF-19 protein plays a crucial role in regulating bile acid biosynthesis by inhibiting CYP7A1 expression through positive regulation of JNK and ERK1/2 cascades. It stimulates glucose uptake in adipocytes, dependent on KLB and FGFR4. FGF-19 Protein, Human (HEK293, Fc) is the recombinant human-derived FGF-19 protein, expressed by HEK293, with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FGF-19 protein plays a crucial role in regulating bile acid biosynthesis by inhibiting CYP7A1 expression through positive regulation of JNK and ERK1/2 cascades. It stimulates glucose uptake in adipocytes, dependent on KLB and FGFR4. FGF-19 Protein, Human (HEK293, Fc) is the recombinant human-derived FGF-19 protein, expressed by HEK293, with C-hFc labeled tag.
Background
The FGF-19 Protein plays a pivotal role in the regulation of bile acid biosynthesis by suppressing CYP7A1 expression through the positive modulation of the JNK and ERK1/2 cascades. Additionally, FGF-19 stimulates glucose uptake in adipocytes, and its activity is contingent upon the presence of both KLB and FGFR4. The protein forms crucial interactions with FGFR1, FGFR2, FGFR3, and FGFR4, emphasizing its involvement in FGF receptor signaling pathways. The affinity between FGFs and their receptors is augmented by KL, KLB, and heparan sulfate glycosaminoglycans, acting as coreceptors. FGF-19 directly interacts with KL and KLB, and in the presence of heparin, KL, or KLB, it forms an interaction with FGFR4. Additionally, FGF-19 interacts with MALRD1, highlighting its diverse molecular associations and suggesting its involvement in intricate cellular processes.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
O95750 (L25-K216)
-
Gene ID9965
-
Molecular Construction
-
N-term
-
FGF-19 (L25-K216)
Accession # O95750 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FGF19; Fibroblast Growth Factor; Fibroblast Growth Factor 19; FGF; FGF-19
-
AA Sequence
LAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
-
Predicted Molecular Mass
47.9 kDa
-
Molecular Weight
Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
