FGF-19 Protein, Human (HEK293, Fc)

FGF-19 protein plays a crucial role in regulating bile acid biosynthesis by inhibiting CYP7A1 expression through positive regulation of JNK and ERK1/2 cascades. It stimulates glucose uptake in adipocytes, dependent on KLB and FGFR4. FGF-19 Protein, Human (HEK293, Fc) is the recombinant human-derived FGF-19 protein, expressed by HEK293, with C-hFc labeled tag.

The FGF-19 Protein plays a pivotal role in the regulation of bile acid biosynthesis by suppressing CYP7A1 expression through the positive modulation of the JNK and ERK1/2 cascades. Additionally, FGF-19 stimulates glucose uptake in adipocytes, and its activity is contingent upon the presence of both KLB and FGFR4. The protein forms crucial interactions with FGFR1, FGFR2, FGFR3, and FGFR4, emphasizing its involvement in FGF receptor signaling pathways. The affinity between FGFs and their receptors is augmented by KL, KLB, and heparan sulfate glycosaminoglycans, acting as coreceptors. FGF-19 directly interacts with KL and KLB, and in the presence of heparin, KL, or KLB, it forms an interaction with FGFR4. Additionally, FGF-19 interacts with MALRD1, highlighting its diverse molecular associations and suggesting its involvement in intricate cellular processes.

Human

HEK293

C-hFc

O95750 (L25-K216)

9965

Full Length of Mature Protein

LAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK

Approximately 50-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of 50 mM Tris, 100 mM Glycine, 25 mM Arginine, 150 mM NaCl, pH7.5 with trehalose as protectant.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.