Copy Link Print Information

FGF-23 Protein, Human (R179Q, HEK293, His)

Customer Review

Based on 1 Customer Validation

FGF-23 protein is an important regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It upregulates EGR1 expression through KL, directly reduces PTH secretion, and negatively regulates osteoblast differentiation and matrix mineralization. FGF-23 Protein, Human (R179Q, HEK293, His) is the recombinant human-derived FGF-23 protein, expressed by HEK293 , with C-His labeled tag and R179Q, , , , mutation.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGF-23 Protein, Human (R179Q, HEK293, His)
  • Experimental Validation Results for FGF-23 Protein, Human (R179Q, HEK293, His)
  • FGF-23 Protein, Human (R179Q, HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

FGF-23 protein is an important regulator of phosphate homeostasis and inhibits renal tubular phosphate transport by reducing SLC34A1 levels. It upregulates EGR1 expression through KL, directly reduces PTH secretion, and negatively regulates osteoblast differentiation and matrix mineralization. FGF-23 Protein, Human (R179Q, HEK293, His) is the recombinant human-derived FGF-23 protein, expressed by HEK293 , with C-His labeled tag and R179Q, , , , mutation.

Background

FGF-23 protein functions as a crucial regulator of phosphate homeostasis, as evidenced by its ability to inhibit renal tubular phosphate transport through the reduction of SLC34A1 levels. Additionally, it plays a role in up-regulating EGR1 expression in the presence of KL and acts directly on the parathyroid to decrease PTH secretion. This protein is involved in the regulation of vitamin-D metabolism and acts as a negative regulator of osteoblast differentiation and matrix mineralization. The interaction of FGF-23 with FGFR1, FGFR2, FGFR3, and FGFR4 further underscores its significance in cellular processes. Furthermore, the affinity between fibroblast growth factors (FGFs) and their receptors is enhanced by KL and heparan sulfate glycosaminoglycans, serving as crucial coreceptors in this regulatory network.

Verified Bioactivity

Determined by its ability to stimulate the proliferation of NIH-3T3 cells. The ED50 for this effect is 4-20 ng/mL in the presence of 1 μg/mL murine Klotho and 100 μg/mL heparin.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Determined by its ability to stimulate the proliferation of NIH-3T3 cells. The ED50 for this effect is 14.84 ng/mL in the presence of 1 μg/mL murine Klotho and 100 μg/mL heparin, corresponding to a specific activity is 6.739×104 units/mg.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q9GZV9 (Y25-I251, R179Q)

  • Gene ID
    8074  [NCBI]
  • Molecular Construction
    • N-term
    • FGF-23 (Y25-I251, R179Q)
      Accession # Q9GZV9
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGF23; FGF-23; Fibroblast Growth Factor 23; HFTC2; Phosphatonin; HPDR2; HYPF; PHPTC; Tumor-Derived Hypophosphatemia Inducing Factor; ADHR; Tumor-Derived Hypophosphatemia-Inducing Factor; FGFN

  • AA Sequence

    YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTQSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

  • Predicted Molecular Mass

    27.3 kDa

  • Molecular Weight

    Approximately 29-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Determined by its ability to stimulate the proliferation of NIH-3T3 cells. The ED50 for this effect is 14.84 ng/mL in the presence of 1 μg/mL murine Klotho and 100 μg/mL heparin, corresponding to a specific activity is 6.739×104 units/mg.

  • FGF-23 Protein, Human (R179Q, HEK293, His) Product Image
    1/16
  • Experimental Validation Results for FGF-23 Protein, Human (R179Q, HEK293, His)
  • Experimental Validation Results for FGF-23 Protein, Human (R179Q, HEK293, His)
  • FGF-23 Protein, Human (R179Q, HEK293, His) Product Image