FGL1 Protein, Human (Biotinylated, HEK293, Avi-His)
FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (Biotinylated, HEK293, Avi-His) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
FGL1 protein is the main ligand of LAG3 and can inhibit antigen-specific T cell activation, mediating the inhibitory function of LAG3 independently of MHC-II binding. FGL1 is secreted by liver cells and contributes to their growth. FGL1 Protein, Human (Biotinylated, HEK293, Avi-His) is the recombinant human-derived FGL1 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.
Background
FGL1 protein functions as an immune suppressive molecule, exerting inhibitory effects on antigen-specific T-cell activation by serving as a major ligand for LAG3. It plays a pivotal role in mediating LAG3's T-cell inhibitory function independently of MHC class II (MHC-II) binding. Beyond its immune-regulatory role, FGL1 is secreted by hepatocytes, contributing to their growth. Existing as a homodimer, FGL1 interacts with LAG3 through its Fibrinogen C-terminal domain, specifically binding to LAG3's Ig-like domains 1 and 2. This molecular interaction, detailed in studies, underscores the significance of FGL1 in modulating immune responses and hepatocyte growth, highlighting its potential as a key player in the regulation of T-cell activation and hepatic functions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-6*His
-
Accession
Q08830 (L23-I312)
-
Molecular Construction
-
N-term
-
FGL1 (L23-I312)
Accession # Q08830 -
Avi-6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Conjugate Method
The single lysine residue in Avitag is biotinylated through an enzymatic reaction.
-
Synonyms
FGL1; Fibrinogen-Like Protein 1; Fibrinogen Like 1; LFIRE-1; HPS; HFREP1; Hepassocin; HP-041; HFREP-1; Hepatocellular Carcinoma-Related Sequence; Hepatocyte-Derived Fibrinogen-Related Protein 1; LFIRE1; Liver Fibrinogen-Related Protein 1
-
AA Sequence
LEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
-
Predicted Molecular Mass
36.6 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
