Fibromodulin Protein, Human (HEK293, hFc)

Fibromodulin is an important regulatory protein that affects fiber formation rate and plays a crucial role in collagen fiber formation. It binds type I and type II collagen, affects fibril formation and organization, and contributes to the structural integrity of the extracellular matrix. Fibromodulin Protein, Human (HEK293, hFc) is the recombinant human-derived Fibromodulin protein, expressed by HEK293 , with C-hFc labeled tag.

Fibromodulin Protein, a crucial regulator, influences the rate of fibril formation and is implicated in collagen fibrillogenesis, potentially playing a primary role in this process. Known to bind both type I and type II collagen, Fibromodulin exerts its impact on the formation and organization of fibrils, contributing to the structural integrity of the extracellular matrix. Its interactions with various collagen types underline its significance in modulating fibrillogenesis and maintaining the architecture of connective tissues, highlighting its pivotal role in the extracellular matrix dynamics.

Human

HEK293

C-hFc

Q06828/NP_002014.2 (Q19-I376)

2331  [NCBI]

Full Length of Mature Protein

QYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI

Approximately 70 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.