Fibromodulin Protein, Human (HEK293, hFc)
Based on 1 Customer Validation
Fibromodulin is an important regulatory protein that affects fiber formation rate and plays a crucial role in collagen fiber formation. It binds type I and type II collagen, affects fibril formation and organization, and contributes to the structural integrity of the extracellular matrix. Fibromodulin Protein, Human (HEK293, hFc) is the recombinant human-derived Fibromodulin protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Fibromodulin is an important regulatory protein that affects fiber formation rate and plays a crucial role in collagen fiber formation. It binds type I and type II collagen, affects fibril formation and organization, and contributes to the structural integrity of the extracellular matrix. Fibromodulin Protein, Human (HEK293, hFc) is the recombinant human-derived Fibromodulin protein, expressed by HEK293 , with C-hFc labeled tag.
Background
Fibromodulin Protein, a crucial regulator, influences the rate of fibril formation and is implicated in collagen fibrillogenesis, potentially playing a primary role in this process. Known to bind both type I and type II collagen, Fibromodulin exerts its impact on the formation and organization of fibrils, contributing to the structural integrity of the extracellular matrix. Its interactions with various collagen types underline its significance in modulating fibrillogenesis and maintaining the architecture of connective tissues, highlighting its pivotal role in the extracellular matrix dynamics.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q06828/NP_002014.2 (Q19-I376)
-
Molecular Construction
-
N-term
-
Fibromodulin (Q19-I376)
Accession # Q06828/NP_002014.2 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
FMOD; KSPG Fibromodulin; Fibromodulin; FM; SLRR2E; Epididymis Secretory Sperm Binding Protein; Keratan Sulfate Proteoglycan Fibromodulin; Fibromodulin Proteoglycan; Collagen-Binding 59 KDa Protein
-
AA Sequence
QYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIEI
-
Predicted Molecular Mass
68.2 kDa
-
Molecular Weight
Approximately 70 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
