FIS1 Protein, Human (His)
Based on 1 Customer Validation
The FIS1 protein is essential for mitochondrial network fragmentation and perinuclear clustering. Although FIS1 plays a minor role in recruiting DNM1L to the mitochondrial surface, it is associated with fission. FIS1 Protein, Human (His) is the recombinant human-derived FIS1 protein, expressed by E. coli , with C-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The FIS1 protein is essential for mitochondrial network fragmentation and perinuclear clustering. Although FIS1 plays a minor role in recruiting DNM1L to the mitochondrial surface, it is associated with fission. FIS1 Protein, Human (His) is the recombinant human-derived FIS1 protein, expressed by E. coli , with C-6*His labeled tag.
The FIS1 Protein plays a crucial role in the fragmentation of the mitochondrial network, contributing to its perinuclear clustering. While it has a minor role in recruiting and associating with the fission mediator dynamin-related protein 1 (DNM1L) on the mitochondrial surface, FIS1 is implicated in mitochondrial fission. Notably, it may not be essential for the assembly of functional fission complexes and subsequent membrane scission events. Beyond its involvement in mitochondrial dynamics, FIS1 also mediates peroxisomal fission, particularly when the outcomes of fission are directed towards mitochondrial homeostasis, mitophagy, or apoptosis. The protein can induce the release of cytochrome c from the mitochondrion to the cytosol, ultimately triggering apoptosis. Interactions with DNM1L/DLP1, MARCHF5, MIEF1, and PEX11A, PEX11B, PEX11G highlight the intricate network of associations that contribute to FIS1's multifaceted role at the interface of mitochondrial and peroxisomal dynamics.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-6*His
-
Accession
Q9Y3D6 (M1-G122)
-
Molecular Construction
-
N-term
-
FIS1 (M1-G122)
Accession # Q9Y3D6 -
6*His
-
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
FIS1; Mitochondrial Fission Molecule; Prev. TTC11; FIS1 Homolog; H_NH0132A01.6; HFis1; CGI-135; Fission 1 (Mitochondrial Outer Membrane) Homolog (S. Cerevisiae); Tetratricopeptide Repeat Protein 11; Fission 1 (Mitochondrial Outer Membrane) Homolog (Yeast)
-
AA Sequence
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG
-
Predicted Molecular Mass
15.3 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
