FKBP7 Protein, Human (HEK293, Fc)
The FKBP7 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that significantly accelerates protein folding, especially in the complexities of protein synthesis. Utilizing its enzymatic abilities, FKBP7 plays a crucial role in coordinating timely conformational changes to achieve correct protein folding and maturation. FKBP7 Protein, Human (HEK293, Fc) is the recombinant human-derived FKBP7 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The FKBP7 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that significantly accelerates protein folding, especially in the complexities of protein synthesis. Utilizing its enzymatic abilities, FKBP7 plays a crucial role in coordinating timely conformational changes to achieve correct protein folding and maturation. FKBP7 Protein, Human (HEK293, Fc) is the recombinant human-derived FKBP7 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
FKBP7 Protein stands out as a peptidyl-prolyl cis-trans isomerase (PPIase) that plays a pivotal role in expediting the folding of proteins, particularly during the intricate process of protein synthesis. Harnessing its enzymatic activity, FKBP7 contributes to the dynamic and timely conformational changes essential for the correct folding and maturation of proteins. As a member of the PPIase family, FKBP7 is adept at catalyzing the cis-trans isomerization of proline imidic peptide bonds, influencing the structural dynamics of nascent or misfolded polypeptides. This functional attribute underscores the protein's significance in maintaining cellular protein homeostasis and underscores its potential impact on cellular physiology. Further investigations are warranted to unravel the specific molecular mechanisms through which FKBP7 actively participates in the intricate choreography of protein folding during synthesis.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-hFc
-
Accession
Q9Y680-2 (Q24-Q218)
-
Molecular Construction
-
N-term
-
FKBP7 (Q24-Q218)
Accession # Q9Y680-2 -
hFc
-
C-term
-
-
Protein Length
Full Length of Isoform-2
-
Synonyms
FKBP7; 23 KDa FKBP; FKBP Prolyl Isomerase 7; Rotamase; FKBP23; FKBP-23; Peptidyl-Prolyl Cis-Trans Isomerase FKBP7; FKBP-7; 23 KDa FK506-Binding Protein; FK506-Binding Protein 23; FK506-Binding Protein 7; Peptidylprolyl Isomerase; FK506 Binding Protein 7;
-
AA Sequence
QRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIETFKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQ
-
Predicted Molecular Mass
49.4 kDa
-
Molecular Weight
Approximately 55 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
