Follistatin/FST Protein, Mouse (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

Follistatin (FST) is a regulator of TGFβ family signaling and acts by selectively binding to TGFβ family ligands and preventing ligand binding to the receptor complex. Follistatin has the ability to suppress the follicle stimulating hormone (FSH). Follistatin/FST Protein, Mouse (HEK293, His) is produced in HEK293 cells with a C-Terminal 10*His-tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

Follistatin (FST) is a regulator of TGFβ family signaling and acts by selectively binding to TGFβ family ligands and preventing ligand binding to the receptor complex. Follistatin has the ability to suppress the follicle stimulating hormone (FSH)[1][2]. Follistatin/FST Protein, Mouse (HEK293, His) is produced in HEK293 cells with a C-Terminal 10*His-tag.

Background

Follistatin is first described as a follicle-stimulating hormone inhibiting substance present in ovarian follicular fluid. Follistatin binds activin A and myostatin with low nanomolar (nM) affinity, completely surrounds the ligand occluding all of the receptor binding sites and binds to the ligand[1][2].
Mature human Follistatin shares 97% amino acid sequence identity with mouse and rat Follistatin.
Follistatin is a 32-35-kDa glycoprotein composed of four domains including an N-terminal domain (ND) followed by three Follistatin domains (FSD1, FSD2, and FSD3). C-terminal splicing of Follistatin can occur to generate various isoforms including FS288 and FS315. Follistatin neutralizes the TGFβ ligands, myostatin and activin A, by forming a nearly irreversible non-signaling complex by surrounding the ligand and preventing interaction with TGFβ receptors. In humans, the gene encoding Follistatin is located on chromosome 5q11.2. The Follistatin protein contains a TGF-β binding site where activins, bone morphonegic proteins (BMPs) and growth differentiation factors (GDFs) are bound with high affinity and thereby neutralised. The ligand binding site for Follistatin overlaps with the type I and type II receptor binding sites for these ligands. Follistatin also contains a heparin binding site where proteoglycans in the extracellular matrix can bind, and therefore Follistatin is believed to bind the extracellular matrix. There are two major isoforms of Follistatin, FST288, which is anchored to the cell surface by interactions with heparin sulfate proteoglycans, and FST315, which is the predominant form found in circulation. The two isoforms arise from alternative splicing; the 315 isoform includes a 27 amino acid acidic C-terminal tail, which Follistatin 288 does not have. The acidic tail on Follistatin 315 neutralises the heparin binding site, thereby inhibiting the binding of Follistatin 315 to the extracellular matrix[1][2][3].
Follistatin as a liver-derived protein under the regulation of glucagon-to-insulin ratio suggests a relation to energy metabolism. In humans, aberrant expression of FST and activins are implicated in infertility. Follistatin is a potent tissue regulator in the gonad, pituitary gland, pregnancy membranes, vasculature, and liver[1][3].

In Vitro

Recombinant mouse Follistatin (.2 μg/mL; 1-48 hours) significantly inhibits P21 mRNA expression, and increases Pcna and Cyclin D2 mRNA expression in CD49f positive cells (CD49f+ cells) isolated from male murine salivary glands[4].

In Vivo

Recombinant mouse Follistatin (.5-1 μg; four does) is administered intranasally (5 μL) 1 h before each challenge in ovalbumin-sensitized BALB/c mice. Follistatin inhibits the allergen-specific Th2 immune response in mediastinal lymph nodes and mucus production in the lung[5].

Verified Bioactivity

1. Measured by its ability to neutralize Activin-mediated inhibition on MPC11 cell proliferation and the ED50 is 0.01-0.08 μg/mL in the presence of 10 ng/mL Human Activin A.
2. Measured in a cell proliferation assay using MPC-11 cells. The ED50 this effect is <0.5 μg/mL, corresponding to a specific activity is > 2×103 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured in a cell proliferation assay using MPC-11 cells. The ED50 this effect is 0.177 μg/mL, corresponding to a specific activity is 5.65×103 units/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FST (G30-W344)
      Accession # P47931-1
    • 10*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    FST; FS; Follistatin; Activin-Binding Protein

  • AA Sequence

    GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGKCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDSKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEETEEEEEEEDQDYSFPISSILEW

  • Predicted Molecular Mass

    36 kDa

  • Molecular Weight

    Approximately 43-54 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% tween 80.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
4.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00