Frizzled-4/CD344 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

Frizzled-4/CD344 is a Wnt receptor that mainly activates the β-catenin pathway and affects retinal vascularization. As a receptor for Wnt proteins and Norrin protein (NDP), it stimulates LEF/TCF-mediated transcriptional programs. Frizzled-4/CD344 Protein, Rat (HEK293, His) is the recombinant rat-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Frizzled-4/CD344 is a Wnt receptor that mainly activates the β-catenin pathway and affects retinal vascularization. As a receptor for Wnt proteins and Norrin protein (NDP), it stimulates LEF/TCF-mediated transcriptional programs. Frizzled-4/CD344 Protein, Rat (HEK293, His) is the recombinant rat-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-His labeled tag.

Background

Frizzled-4/CD344, a receptor for Wnt proteins, predominantly engages the beta-catenin canonical signaling pathway, initiating a cascade involving disheveled proteins, GSK-3 kinase inhibition, nuclear accumulation of beta-catenin (CTNNB1), and activation of Wnt target genes. Its pivotal role in retinal vascularization is underscored as it acts as a receptor for both Wnt proteins and norrin (NDP), contributing to beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs. Frizzled-4/CD344 can be activated by Wnt protein binding as well as Wnt-independent signaling via norrin (NDP). Additionally, a second pathway involving PKC and calcium fluxes, possibly integrated with the canonical pathway, has been observed for some family members. Implications extend to tissue morphogenesis and intercellular transmission of polarity information. Frizzled-4/CD344's interactions with MAGI3, NDP, and participation in a complex with TSPAN12 and norrin (NDP) emphasize its multifaceted role. The competitive binding of TSKU and interaction with glypican GPC3 further add nuances to its regulatory functions within intricate signaling networks.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-4, at 0.1μg/mL (100 μL/well) can bind Wnt-5a.The ED50 for this effect is 32.28 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-4, at 0.1 μg/mL (100 μL/well) can bind Wnt-5a.The ED50 for this effect is 32.28 ng/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FZD4 (F38-E181)
      Accession # Q9QZH0/NP_072145.1
    • His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    FZD4; Frizzled Homolog 4 (Drosophila); Prev. EVR1; Exudative Vitreoretinopathy 1; CD344; WNT Receptor Frizzled-4; Frizzled 4, Seven Transmembrane Spanning Receptor; Frizzled Homolog 4; Frizzled Family Receptor 4; CD344 Antigen; Frizzled-4; FZD4S; Fz-4; FE

  • AA Sequence

    FGDEEERRCDPIRIAMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE

  • Molecular Weight

    Approximately 23-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00