Frizzled-4/CD344 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
Frizzled-4/CD344 is a Wnt receptor that mainly activates the β-catenin pathway and affects retinal vascularization. As a receptor for Wnt proteins and Norrin protein (NDP), it stimulates LEF/TCF-mediated transcriptional programs. Frizzled-4/CD344 Protein, Rat (HEK293, His) is the recombinant rat-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Frizzled-4/CD344 is a Wnt receptor that mainly activates the β-catenin pathway and affects retinal vascularization. As a receptor for Wnt proteins and Norrin protein (NDP), it stimulates LEF/TCF-mediated transcriptional programs. Frizzled-4/CD344 Protein, Rat (HEK293, His) is the recombinant rat-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-His labeled tag.
Background
Frizzled-4/CD344, a receptor for Wnt proteins, predominantly engages the beta-catenin canonical signaling pathway, initiating a cascade involving disheveled proteins, GSK-3 kinase inhibition, nuclear accumulation of beta-catenin (CTNNB1), and activation of Wnt target genes. Its pivotal role in retinal vascularization is underscored as it acts as a receptor for both Wnt proteins and norrin (NDP), contributing to beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs. Frizzled-4/CD344 can be activated by Wnt protein binding as well as Wnt-independent signaling via norrin (NDP). Additionally, a second pathway involving PKC and calcium fluxes, possibly integrated with the canonical pathway, has been observed for some family members. Implications extend to tissue morphogenesis and intercellular transmission of polarity information. Frizzled-4/CD344's interactions with MAGI3, NDP, and participation in a complex with TSPAN12 and norrin (NDP) emphasize its multifaceted role. The competitive binding of TSKU and interaction with glypican GPC3 further add nuances to its regulatory functions within intricate signaling networks.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-4, at 0.1μg/mL (100 μL/well) can bind Wnt-5a.The ED50 for this effect is 32.28 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-His
-
Accession
Q9QZH0/NP_072145.1 (F38-E181)
-
Molecular Construction
-
N-term
-
FZD4 (F38-E181)
Accession # Q9QZH0/NP_072145.1 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
FZD4; Frizzled Homolog 4 (Drosophila); Prev. EVR1; Exudative Vitreoretinopathy 1; CD344; WNT Receptor Frizzled-4; Frizzled 4, Seven Transmembrane Spanning Receptor; Frizzled Homolog 4; Frizzled Family Receptor 4; CD344 Antigen; Frizzled-4; FZD4S; Fz-4; FE
-
AA Sequence
FGDEEERRCDPIRIAMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
-
Molecular Weight
Approximately 23-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)