Frizzled-4/CD344 Protein, Rat (HEK293, His)

Frizzled-4/CD344 is a Wnt receptor that mainly activates the β-catenin pathway and affects retinal vascularization. As a receptor for Wnt proteins and Norrin protein (NDP), it stimulates LEF/TCF-mediated transcriptional programs. Frizzled-4/CD344 Protein, Rat (HEK293, His) is the recombinant rat-derived Frizzled-4/CD344 protein, expressed by HEK293 , with C-His labeled tag. The total length of Frizzled-4/CD344 Protein, Rat (HEK293, His) is 144 a.a., with molecular weight of ~23-30 kDa.

Frizzled-4/CD344, a receptor for Wnt proteins, predominantly engages the beta-catenin canonical signaling pathway, initiating a cascade involving disheveled proteins, GSK-3 kinase inhibition, nuclear accumulation of beta-catenin (CTNNB1), and activation of Wnt target genes. Its pivotal role in retinal vascularization is underscored as it acts as a receptor for both Wnt proteins and norrin (NDP), contributing to beta-catenin (CTNNB1) accumulation and stimulation of LEF/TCF-mediated transcriptional programs. Frizzled-4/CD344 can be activated by Wnt protein binding as well as Wnt-independent signaling via norrin (NDP). Additionally, a second pathway involving PKC and calcium fluxes, possibly integrated with the canonical pathway, has been observed for some family members. Implications extend to tissue morphogenesis and intercellular transmission of polarity information. Frizzled-4/CD344's interactions with MAGI3, NDP, and participation in a complex with TSPAN12 and norrin (NDP) emphasize its multifaceted role. The competitive binding of TSKU and interaction with glypican GPC3 further add nuances to its regulatory functions within intricate signaling networks.

Measured by its binding ability in a functional ELISA. Immobilized Human Frizzled-4, at 0.1μg/mL (100 μL/well) can bind Wnt-5a.The ED₅₀ for this effect is 32.28 ng/mL.

Rat

HEK293

C-His

Q9QZH0/NP_072145.1 (F38-E181)

64558  [NCBI]

FGDEEERRCDPIRIAMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPDSLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE

Approximately 23-30 kDa due to the glycosylation

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.