1. Recombinant Proteins
  2. Others
  3. FXR Protein, Human

FXR Protein, Human is the recombinant human-derived FXR, expressed by E. coli , with tag Free labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FXR Protein, Human is the recombinant human-derived FXR, expressed by E. coli , with tag Free labeled tag.

Background

FXR is a ligand-activated transcription factor that serves as a receptor for bile acids (BAs), including chenodeoxycholic acid (CDCA), lithocholic acid, deoxycholic acid (DCA), and allocholic acid (ACA). It plays a crucial role in BA homeostasis by regulating genes involved in BA synthesis, conjugation, and enterohepatic circulation. Additionally, FXR modulates lipid and glucose metabolism and participates in innate immune responses. The FXR-RXR heterodimer primarily binds to farnesoid X receptor response elements (FXREs) containing two inverted repeats of the consensus sequence 5'-AGGTCA-3' (IR-1), with lower affinity for tandem repeat DR1 sites. In the liver, FXR activates transcription of the corepressor NR0B2, indirectly inhibiting CYP7A1 and CYP8B1 (involved in BA synthesis) through epigenetic repression mediated by histone demethylase KDM1A. It also activates genes such as SLC10A1/NTCP (BA uptake), SLC27A5/BACS, BAAT (BA conjugation), ABCB11/BSEP (bile salt export), ABCC2/MRP2, and ABCB4 (phosphatidylcholine secretion). In the intestine, FXR induces FGF19 expression, which suppresses hepatic CYP7A1. Furthermore, FXR regulates lipid metabolism by modulating SREBF1, PLTP, SCARB1, APOE, and other genes, and influences glucose homeostasis via NR0B2/SHP-mediated repression. FXR also contributes to intestinal innate immunity by suppressing inflammatory cytokines and maintaining epithelial barrier integrity. By similarity: FXR transcriptional activity is modulated by monomeric nuclear receptors (e.g., NR5A2/LRH-1) binding to coregulatory NRE half-sites; it coordinates FGF19 action through hepatic KLB/beta-klotho induction; regulates glycogen synthesis; inhibits bacterial overgrowth in the gut; and exhibits anti-inflammatory effects in liver inflammation.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q96RI1-3 (E258-Q486)

Gene ID

9971

Protein Length

Partial

Synonyms
BAR; FXR; HRR1; RIP14
AA Sequence

ELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ

Molecular Weight

Approximately 26.9 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES , pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

FXR Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

FXR Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FXR Protein, Human
Cat. No.:
HY-P703605
Quantity:
MCE Japan Authorized Agent: