GABARAP Protein, Human (His, Fc)
Based on 1 Customer Validation
GABARAP (gamma-aminobutyric acid receptor-associated protein) is a protein that performs multiple functions within cells. As a ubiquitin-like modifier, it participates in the intracellular transport of GABA(A) receptors and interacts with the cytoskeleton. GABARAP Protein, Human (His, Fc) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-His, C-hFc labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
GABARAP (gamma-aminobutyric acid receptor-associated protein) is a protein that performs multiple functions within cells. As a ubiquitin-like modifier, it participates in the intracellular transport of GABA(A) receptors and interacts with the cytoskeleton. GABARAP Protein, Human (His, Fc) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-His, C-hFc labeled tag.
Background
GABARAP (Gamma-aminobutyric acid receptor-associated protein) is a protein that serves multiple functions within the cell. It acts as a ubiquitin-like modifier, participating in the intracellular transport of GABA(A) receptors and interacting with the cytoskeleton. GABARAP is involved in autophagy, specifically in the later stages of autophagosome maturation. It interacts with the reticulophagy receptor TEX264 to remodel subdomains of the endoplasmic reticulum into autophagosomes, which then merge with lysosomes for turnover of the endoplasmic reticulum. GABARAP is also essential for the local activation of the CUL3(KBTBD6/7) E3 ubiquitin ligase complex, which regulates the ubiquitination and degradation of TIAM1, a guanyl-nucleotide exchange factor. This degradation of TIAM1 affects downstream signal transduction pathways involved in cell migration, proliferation, and cytoskeleton organization. Additionally, GABARAP has been implicated in apoptosis. Overall, GABARAP plays a vital role in various biological processes, including intracellular transport, autophagy, cytoskeleton organization, and cell signaling.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His;C-hFc
-
Accession
Q6IAW1 (M1-L117)
-
Molecular Construction
-
N-term
-
6*His
-
GABARAP (M1-L117)
Accession # Q6IAW1 -
hFc
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
GABARAP; Epididymis Secretory Sperm Binding Protein; GABA Type A Receptor-Associated Protein; GABARAP-A; GABA(A) Receptor-Associated Protein; HCG1987397, Isoform CRA_b; MM46; GABARAP Protein; ATG8A; FLC3B; Gamma-Aminobutyric Acid Receptor-Associated Prote
-
AA Sequence
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
-
Predicted Molecular Mass
43.2 kDa
-
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 20% glycerol, pH 7.0.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)