GABARAP Protein, Human (His, Fc)

Customer Review

Based on 1 Customer Validation

GABARAP (gamma-aminobutyric acid receptor-associated protein) is a protein that performs multiple functions within cells. As a ubiquitin-like modifier, it participates in the intracellular transport of GABA(A) receptors and interacts with the cytoskeleton. GABARAP Protein, Human (His, Fc) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-His, C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

GABARAP (gamma-aminobutyric acid receptor-associated protein) is a protein that performs multiple functions within cells. As a ubiquitin-like modifier, it participates in the intracellular transport of GABA(A) receptors and interacts with the cytoskeleton. GABARAP Protein, Human (His, Fc) is the recombinant human-derived GABARAP protein, expressed by E. coli , with N-His, C-hFc labeled tag.

Background

GABARAP (Gamma-aminobutyric acid receptor-associated protein) is a protein that serves multiple functions within the cell. It acts as a ubiquitin-like modifier, participating in the intracellular transport of GABA(A) receptors and interacting with the cytoskeleton. GABARAP is involved in autophagy, specifically in the later stages of autophagosome maturation. It interacts with the reticulophagy receptor TEX264 to remodel subdomains of the endoplasmic reticulum into autophagosomes, which then merge with lysosomes for turnover of the endoplasmic reticulum. GABARAP is also essential for the local activation of the CUL3(KBTBD6/7) E3 ubiquitin ligase complex, which regulates the ubiquitination and degradation of TIAM1, a guanyl-nucleotide exchange factor. This degradation of TIAM1 affects downstream signal transduction pathways involved in cell migration, proliferation, and cytoskeleton organization. Additionally, GABARAP has been implicated in apoptosis. Overall, GABARAP plays a vital role in various biological processes, including intracellular transport, autophagy, cytoskeleton organization, and cell signaling.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His;C-hFc
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • GABARAP (M1-L117)
      Accession # Q6IAW1
    • hFc
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    GABARAP; Epididymis Secretory Sperm Binding Protein; GABA Type A Receptor-Associated Protein; GABARAP-A; GABA(A) Receptor-Associated Protein; HCG1987397, Isoform CRA_b; MM46; GABARAP Protein; ATG8A; FLC3B; Gamma-Aminobutyric Acid Receptor-Associated Prote

  • AA Sequence

    MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL

  • Predicted Molecular Mass

    43.2 kDa

  • Molecular Weight

    Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, 20% glycerol, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00