Galectin-3/LGALS3 Protein, Rat (His)
Galectin-3/LGALS3 protein binds IgE and cooperates with integrins α-3 and β-1 to promote endothelial cell migration.It contributes to epithelial cell differentiation and acts as a splicing factor in the nucleus. Galectin-3/LGALS3 Protein, Rat (His) is the recombinant rat-derived Galectin-3/LGALS3 protein, expressed by E. coli, with N-His labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Help & FAQs
Biological Activity
Description
Galectin-3/LGALS3 protein binds IgE and cooperates with integrins α-3 and β-1 to promote endothelial cell migration.It contributes to epithelial cell differentiation and acts as a splicing factor in the nucleus. Galectin-3/LGALS3 Protein, Rat (His) is the recombinant rat-derived Galectin-3/LGALS3 protein, expressed by E. coli, with N-His labeled tag.
Background
Galectin-3 (LGALS3) functions as a galactose-specific lectin with the ability to bind IgE and, in collaboration with the alpha-3, beta-1 integrin, participates in the CSPG4-induced stimulation of endothelial cell migration. Alongside DMBT1, it is essential for the terminal differentiation of columnar epithelial cells during early embryogenesis. In the nucleus, Galectin-3 acts as a pre-mRNA splicing factor. Outside the nucleus, it plays a crucial role in acute inflammatory responses, involving neutrophil activation and adhesion, monocyte macrophage chemoattraction, opsonization of apoptotic neutrophils, and mast cell activation. Furthermore, in coordination with TRIM16, Galectin-3 facilitates the recognition of membrane damage, mobilizing core autophagy regulators ATG16L1 and BECN1 in response to damaged endomembranes. The protein likely forms homo- or heterodimers and interacts with various partners, including DMBT1, CD6, ALCAM, ITGA3, ITGB1, CSPG4, LGALS3BP, LYPD3, ZFTRAF1, and UACA, with the interaction with TRIM16 mediating the autophagy of damaged endomembranes.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag N-6*His
-
Accession
P08699 (A2-I262)
-
Gene ID83781
-
Molecular Construction
-
N-term
-
6*His
-
LGALS3 (A2-I262)
Accession # P16110 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
LGALS3; MAC-2; Prev. LGALS2; MAC2; GALIG; Galactoside-Binding Protein; Epididymis Secretory Sperm Binding Protein; MAC-2 Antigen; Advanced Glycation End-Product Receptor 3; Mac-2 Antigen; Lectin, Galactoside-Binding, Soluble, 3; Galectin; Carbohydrate-Binding Protein 35; CBP 35; Galactose-Specific Lectin 3; CBP35; Laminin-Binding Protein; Gal-3; IgE-Binding Protein; GAL3; 35 KDa Lectin; L-31; Lectin L-29; L31; Galectin-3; Galectin 3; GALBP
-
AA Sequence
ADGFSLNDALAGSGNPNPQGWPGAWGNQPGAGGYPGASYPGAYPGQAPPGGYPGQAPPSAYPGPTGPSAYPGPTAPGAYPGPTAPGAFPGQPGGPGAYPSAPGAYPSAPGAYPATGPFGAPTGPLTVPYDMPLPGGVMPRMLITIIGTVKPNANSITLNFKKGNDIAFHFNPRFNENNRRVIVCNTKQDNNWGREERQSAFPFESGKPFKIQVLVEADHFKVAVNDVHLLQYNHRMKNLREISQLGIIGDITLTSASHAMI
-
Predicted Molecular Mass
31.1 kDa
-
Purity
≥ 90%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
