Gastrokine 1 Protein, Human (sf9, His)

Customer Review

Based on 1 Customer Validation

Gastrokine 1 protein exerts mitogenic activity, likely preserving the structural integrity of the gastric mucosal epithelium. Gastrokine 1 Protein, Human (sf9, His) is the recombinant human-derived Gastrokine 1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Gastrokine 1 protein exerts mitogenic activity, likely preserving the structural integrity of the gastric mucosal epithelium. Gastrokine 1 Protein, Human (sf9, His) is the recombinant human-derived Gastrokine 1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The Gastrokine 1 protein exerts mitogenic activity and is likely implicated in the preservation of the structural integrity of the gastric mucosal epithelium.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GKN1 (N21-N185)
      Accession # Q9NS71
    • His
    • C-term
  • Protein Length

    Full Length of Gastrokine-1 Chain

  • Synonyms

    GKN1; BRICD1; Gastrokine 1; BRICHOS Domain Containing 1; AMP18; FOV; CA11; Protein CA11; 18 KDa Antrum Mucosa Protein; Foveolin; Gastrokine-1; AMP-18

  • AA Sequence

    NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

  • Predicted Molecular Mass

    19.6 kDa

  • Molecular Weight

    Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00