1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. TGF-beta Superfamily Neurotrophic Factors Cytokine Receptors
  4. GDNF family
  5. GFR-alpha-3
  6. GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His)

GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His)

Cat. No.: HY-P77373
Handling Instructions Technical Support

GFRA3/GDNFR-alpha-3 Protein, as the receptor for glial cell line-derived neurotrophic factor ARTN, is crucial for mediating RET receptor tyrosine kinase autophosphorylation and activation upon artemin stimulation. Its interaction with SORL1 suggests involvement in diverse cellular signaling pathways. GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His) is the recombinant human-derived GFRA3/GDNFR-alpha-3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GFRA3/GDNFR-alpha-3 Protein, as the receptor for glial cell line-derived neurotrophic factor ARTN, is crucial for mediating RET receptor tyrosine kinase autophosphorylation and activation upon artemin stimulation. Its interaction with SORL1 suggests involvement in diverse cellular signaling pathways. GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His) is the recombinant human-derived GFRA3/GDNFR-alpha-3 protein, expressed by HEK293 , with C-His labeled tag.

Background

GFRA3/GDNFR-alpha-3 Protein functions as the receptor for the glial cell line-derived neurotrophic factor, ARTN (artemin). It plays a crucial role in mediating the autophosphorylation and activation of the RET receptor tyrosine kinase upon stimulation by artemin. Additionally, GFRA3/GDNFR-alpha-3 interacts with SORL1, indicating its involvement in various cellular signaling pathways.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Artemin at 1 µg/mL can bind Human GFRA3 with an apparent KD is 1.463 nM.

  • Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Artemin at 1 µg/mL can bind Human GFRA3 with an apparent KD is 1.463 nM.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

O60609-1/NP_001487.2 (D32-W382)

Gene ID
Molecular Construction
N-term
GFRA3 (D32-W382)
Accession # O60609/NP_001487.2
His
C-term
Protein Length

Partial

Synonyms
GDNF family receptor alpha-3; GFR-alpha-3; GFRA3
AA Sequence

DPLPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDWPHPTFAVMAHQNENPAVRPQPW

Molecular Weight

Approximately 50-57 kDa due to the glycosylation

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His)
Cat. No.:
HY-P77373
Quantity:
MCE Japan Authorized Agent: