Copy Link Print Information

GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

GFRA3/GDNFR-alpha-3 Protein, as the receptor for glial cell line-derived neurotrophic factor ARTN, is crucial for mediating RET receptor tyrosine kinase autophosphorylation and activation upon artemin stimulation. Its interaction with SORL1 suggests involvement in diverse cellular signaling pathways. GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His) is the recombinant human-derived GFRA3/GDNFR-alpha-3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His)
  • Experimental Validation Results for GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His)
  • GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

GFRA3/GDNFR-alpha-3 Protein, as the receptor for glial cell line-derived neurotrophic factor ARTN, is crucial for mediating RET receptor tyrosine kinase autophosphorylation and activation upon artemin stimulation. Its interaction with SORL1 suggests involvement in diverse cellular signaling pathways. GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His) is the recombinant human-derived GFRA3/GDNFR-alpha-3 protein, expressed by HEK293 , with C-His labeled tag.

Background

GFRA3/GDNFR-alpha-3 Protein functions as the receptor for the glial cell line-derived neurotrophic factor, ARTN (artemin). It plays a crucial role in mediating the autophosphorylation and activation of the RET receptor tyrosine kinase upon stimulation by artemin. Additionally, GFRA3/GDNFR-alpha-3 interacts with SORL1, indicating its involvement in various cellular signaling pathways.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Artemin at 1 µg/mL can bind Human GFRA3 with an apparent KD is 1.463 nM.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Artemin at 1 µg/mL can bind Human GFRA3 with an apparent KD is 1.463 nM.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    O60609-1/NP_001487.2 (D32-W382)

  • Gene ID
    2676  [NCBI]
  • Molecular Construction
    • N-term
    • GFRA3 (D32-W382)
      Accession # O60609/NP_001487.2
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    GFRA3; GFR-Alpha-3; GDNF Family Receptor Alpha 3; GFRa-3; GDNF Family Receptor Alpha-3; Glial Cell Line-Derived Neurotrophic Factor Receptor Alpha-3; GDNF Receptor Alpha-3; GPI-Linked Receptor; GDNFR-Alpha-3; GDNFR3

  • AA Sequence

    DPLPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDWPHPTFAVMAHQNENPAVRPQPW

  • Molecular Weight

    Approximately 50 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human Artemin at 1 µg/mL can bind Human GFRA3 with an apparent KD is 1.463 nM.

  • GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His)
  • Experimental Validation Results for GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His)
  • GFRA3/GDNFR-alpha-3 Protein, Human (HEK293, His) Product Image