GIP Protein, Mouse (HEK293, Fc)

GIP protein is a potent stimulator of insulin secretion that critically regulates glucose homeostasis by promoting insulin release from pancreatic beta cells. GIP has limited inhibitory effects on gastric acid secretion and plays dual roles in nutrient sensing and metabolic regulation, particularly in postprandial glucose metabolism. GIP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived GIP protein, expressed by HEK293 , with C-hFc labeled tag.

GIP Protein emerges as a potent stimulator of insulin secretion, playing a crucial role in glucose homeostasis. Its primary function lies in promoting the release of insulin from pancreatic beta cells, contributing to the regulation of blood glucose levels. In contrast, GIP demonstrates a relatively limited inhibitory effect on gastric acid secretion. This dual role positions GIP as a key player in the intricate interplay between nutrient sensing and metabolic regulation, particularly in the context of postprandial glucose metabolism. The protein's ability to enhance insulin secretion underscores its significance in the control of glucose metabolism, making it a target of interest in understanding and potentially modulating metabolic processes associated with diabetes and insulin resistance.

Mouse

HEK293

C-hFc

P48756 (E22-Q85)

14607  [NCBI]

Full Length of Mature Peptide (with Propeptide)

EKEEVEFRSHAKFAGPRPRGPRYAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ

Predicted MW is 34.3 kDa. Due to glycosylation, the protein migrates to 40-45 kDa based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.