Copy Link Print Information

GITR Protein, Cynomolgus (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

GITR Protein, Cynomolgus (HEK293, Fc) is the recombinant Rhesus Macaque-derived GITR protein, expressed by HEK293, with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for GITR Protein, Cynomolgus (HEK293, Fc)
  • Experimental Validation Results for GITR Protein, Cynomolgus (HEK293, Fc)
  • GITR Protein, Cynomolgus (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

GITR Protein, Cynomolgus (HEK293, Fc) is the recombinant Rhesus Macaque-derived GITR protein, expressed by HEK293, with C-hFc labeled tag.

Background

GITR (Glucocorticoid-induced TNFR-related protein, also known as TNFRSF18) is a type I transmembrane protein. GITR stimulates T lymphocyte proliferation and partially reverses the immunosuppressive function of CD4+CD25+ treg. GITR is expressed on regulatory T cells (Tregs) and some activated immune cells, including effector T lymphocytes, natural killer (NK) cells, and neutrophils. The amino acid sequence of human GITR protein has low homology with that of mouse GITR protein. GITR does not have any enzymatic activity, and the signal is propagated by recruiting members of the TRAF1 family, specifically TRAF1, TRAF2, and TRAF5, into the GITR signaling complex. Signal transduction is then mediated through the NF-kB and MAPK pathways. Protects T cells from cell death induced by TCR activation. GITR is activated by its ligand GITRL (TNFSF18). The NOS induction effect of GITR on mouse macrophages was time-dependent and dose-dependent. GITR inhibits proliferation and induces apoptosis of Multiple Myeloma (MM) cells in vitro and in vivo[1][2][3][4].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque GITR at 5 μg/mL (100 μL/well) can bind Biotinylated GITR Ligand. The ED50 for this effect is 0.9219 μg/mL, corresponding to a specific activity is 1.08×10^3 Unit/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque GITR at 5 μg/mL (100 μL/well) can bind Biotinylated GITR Ligand. The ED50 for this effect is 0.9219 μg/mL, corresponding to a specific activity is 1.08×103 Unit/mg.

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag C-hFc
  • Accession

    XP_005545180.2 (Q20-E155)

  • Gene ID
    102146362
  • Molecular Construction
    • N-term
    • GITR (Q20-E155)
      Accession # XP_005545180.2
    • hFc
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TNFRSF18; Glucocorticoid-Induced TNFR-Related Protein; TNF Receptor Superfamily Member 18; Activation-Inducible TNFR Family Receptor; AITR; Tumor Necrosis Factor Receptor Superfamily Member 18 Isoform 4; GITR; TNF Receptor Superfamily Activation-Inducible

  • AA Sequence

    QRPTGGPGCGPGRLLLGTGKDARCCRVHPTRCCRDYQSEECCSEWDCVCVQPEFHCGNPCCTTCQHHPCPSGQGVQPQGKFSFGFRCVDCALGTFSRGHDGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAE

  • Predicted Molecular Mass

    40.7 kDa

  • Molecular Weight

    Approximately 49 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCL, 100 mM arginine, 150 mM Glycine, pH 7.5.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Rhesus macaque GITR at 5 μg/mL (100 μL/well) can bind Biotinylated GITR Ligand. The ED50 for this effect is 0.9219 μg/mL, corresponding to a specific activity is 1.08×103 Unit/mg.

  • GITR Protein, Cynomolgus (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for GITR Protein, Cynomolgus (HEK293, Fc)
  • Experimental Validation Results for GITR Protein, Cynomolgus (HEK293, Fc)
  • GITR Protein, Cynomolgus (HEK293, Fc) Product Image