1. Recombinant Proteins
  2. Viral Proteins
  3. glycoprotein/G1 Protein, RVFV (sf9, His)

RVFV is an RNA virus in the Phlebovirus genus of the Bunyaviridae family. The virus is enveloped, spherical, and has a diameter of approximately 80-120 nm. G1 is a glycoprotein that enter the viral envelope to form a ribonucleoprotein complex (RNP) with the N protein. RVFV is a high-risk pathogen that can induce fatal encephalitis and hemorrhagic fever in humans and ruminants. glycoprotein/G1 Protein, RVFV (sf9, His) is the recombinant Virus-derived glycoprotein/G1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

RVFV is an RNA virus in the Phlebovirus genus of the Bunyaviridae family. The virus is enveloped, spherical, and has a diameter of approximately 80-120 nm. G1 is a glycoprotein that enter the viral envelope to form a ribonucleoprotein complex (RNP) with the N protein. RVFV is a high-risk pathogen that can induce fatal encephalitis and hemorrhagic fever in humans and ruminants[1][2]. glycoprotein/G1 Protein, RVFV (sf9, His) is the recombinant Virus-derived glycoprotein/G1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The RVFV viral envelope is coated with surface glycoprotein projections of 10 nm in diameter, while the nucleic acids that comprise the viral genome are located within the nucleocapsid. The nucleic acids that make up the RVFV genome are single-stranded antisense RNA molecules that consist of small (S), medium (M), and large (L) segments. The S segment, which is comprised of 1690 nucleotides (nt), encodes the N and NSs proteins; the M segment (3885 nt) encodes the G2 (Gn), G1 (Gc), and NSm proteins; and the L segment (6404 nt) encodes the L protein (an RNA-dependent RNA polymerase). The RVFV N and L proteins are responsible for viral replication and transcription. G2 and G1 are glycoproteins that enter the viral envelope to form a ribonucleoprotein complex (RNP) with the N protein. Additionally, the RNP and L protein jointly package the viral particle. NSm and NSs are nonstructural proteins[1].

Species

Virus

Source

Sf9 insect cells

Tag

C-His

Accession

ABD38821 (P156-T581)

Gene ID

/

Molecular Construction
N-term
RVFV G1 (P156-T581)
Accession # ABD38821
His
C-term
Protein Length

Partial

Synonyms
Rift Valley fever virus (RVFV) (strain MP12) glycoprotein/G1 Protein
AA Sequence

PHLRNRPGKGHNYIDGMTQEDATCKPVTYAGACSSFDVLLEKGKFPLFQSYAHHRTLLEAVHDTIIAKADPPSCDLLSAHGNPCMKEKLVMKTHCPNDYQSAHHLNNDGKMASVKCPPKYELTEDCNFCRQMTGASLKKGSYPLQDLFCQSSEDDGSKLKTKMKGVCEVGVQALKKCDGQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFEHKGQYKGTMDSGQTKRELKSFDISQCPKIGGHGSKKCTGDAAFCSAYECTAQYANAYCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRELSAKPIQRVEPCTTCITKCEPHGLVVRSTGFKISSAVACASGVCVTGSQSPSTEITLKYPGISQSSGGDIGVHMAHDDQSVSSKIVAHCPPQDPCLVHDCIVCAHGLINYQCHT

Predicted Molecular Mass
47.8 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

glycoprotein/G1 Protein, RVFV (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

glycoprotein/G1 Protein, RVFV (sf9, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
glycoprotein/G1 Protein, RVFV (sf9, His)
Cat. No.:
HY-P76576
수량:
MCE Japan Authorized Agent: