1. Recombinant Proteins
  2. Viral Proteins
  3. glycoprotein/G1 Protein, RVFV (sf9, His)

RVFV is an RNA virus in the Phlebovirus genus of the Bunyaviridae family. The virus is enveloped, spherical, and has a diameter of approximately 80-120 nm. G1 is a glycoprotein that enter the viral envelope to form a ribonucleoprotein complex (RNP) with the N protein. RVFV is a high-risk pathogen that can induce fatal encephalitis and hemorrhagic fever in humans and ruminants. glycoprotein/G1 Protein, RVFV (sf9, His) is the recombinant Virus-derived glycoprotein/G1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

RVFV is an RNA virus in the Phlebovirus genus of the Bunyaviridae family. The virus is enveloped, spherical, and has a diameter of approximately 80-120 nm. G1 is a glycoprotein that enter the viral envelope to form a ribonucleoprotein complex (RNP) with the N protein. RVFV is a high-risk pathogen that can induce fatal encephalitis and hemorrhagic fever in humans and ruminants[1][2]. glycoprotein/G1 Protein, RVFV (sf9, His) is the recombinant Virus-derived glycoprotein/G1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The RVFV viral envelope is coated with surface glycoprotein projections of 10 nm in diameter, while the nucleic acids that comprise the viral genome are located within the nucleocapsid. The nucleic acids that make up the RVFV genome are single-stranded antisense RNA molecules that consist of small (S), medium (M), and large (L) segments. The S segment, which is comprised of 1690 nucleotides (nt), encodes the N and NSs proteins; the M segment (3885 nt) encodes the G2 (Gn), G1 (Gc), and NSm proteins; and the L segment (6404 nt) encodes the L protein (an RNA-dependent RNA polymerase). The RVFV N and L proteins are responsible for viral replication and transcription. G2 and G1 are glycoproteins that enter the viral envelope to form a ribonucleoprotein complex (RNP) with the N protein. Additionally, the RNP and L protein jointly package the viral particle. NSm and NSs are nonstructural proteins[1].

Species

Virus

Source

Sf9 insect cells

Tag

C-His

Accession

ABD38821 (P156-T581)

Gene ID

/

Molecular Construction
N-term
RVFV G1 (P156-T581)
Accession # ABD38821
His
C-term
Protein Length

Partial

Synonyms
Rift Valley fever virus (RVFV) (strain MP12) glycoprotein/G1 Protein
AA Sequence

PHLRNRPGKGHNYIDGMTQEDATCKPVTYAGACSSFDVLLEKGKFPLFQSYAHHRTLLEAVHDTIIAKADPPSCDLLSAHGNPCMKEKLVMKTHCPNDYQSAHHLNNDGKMASVKCPPKYELTEDCNFCRQMTGASLKKGSYPLQDLFCQSSEDDGSKLKTKMKGVCEVGVQALKKCDGQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFEHKGQYKGTMDSGQTKRELKSFDISQCPKIGGHGSKKCTGDAAFCSAYECTAQYANAYCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRELSAKPIQRVEPCTTCITKCEPHGLVVRSTGFKISSAVACASGVCVTGSQSPSTEITLKYPGISQSSGGDIGVHMAHDDQSVSSKIVAHCPPQDPCLVHDCIVCAHGLINYQCHT

Predicted Molecular Mass
47.8 kDa
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

glycoprotein/G1 Protein, RVFV (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

glycoprotein/G1 Protein, RVFV (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
glycoprotein/G1 Protein, RVFV (sf9, His)
Cat. No.:
HY-P76576
Quantity:
MCE Japan Authorized Agent: