glycoprotein/G1 Protein, RVFV (sf9, His)

RVFV is an RNA virus in the Phlebovirus genus of the Bunyaviridae family. The virus is enveloped, spherical, and has a diameter of approximately 80-120 nm. G1 is a glycoprotein that enter the viral envelope to form a ribonucleoprotein complex (RNP) with the N protein. RVFV is a high-risk pathogen that can induce fatal encephalitis and hemorrhagic fever in humans and ruminants. glycoprotein/G1 Protein, RVFV (sf9, His) is the recombinant Virus-derived glycoprotein/G1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

RVFV is an RNA virus in the Phlebovirus genus of the Bunyaviridae family. The virus is enveloped, spherical, and has a diameter of approximately 80-120 nm. G1 is a glycoprotein that enter the viral envelope to form a ribonucleoprotein complex (RNP) with the N protein. RVFV is a high-risk pathogen that can induce fatal encephalitis and hemorrhagic fever in humans and ruminants[1][2]. glycoprotein/G1 Protein, RVFV (sf9, His) is the recombinant Virus-derived glycoprotein/G1 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

The RVFV viral envelope is coated with surface glycoprotein projections of 10 nm in diameter, while the nucleic acids that comprise the viral genome are located within the nucleocapsid. The nucleic acids that make up the RVFV genome are single-stranded antisense RNA molecules that consist of small (S), medium (M), and large (L) segments. The S segment, which is comprised of 1690 nucleotides (nt), encodes the N and NSs proteins; the M segment (3885 nt) encodes the G2 (Gn), G1 (Gc), and NSm proteins; and the L segment (6404 nt) encodes the L protein (an RNA-dependent RNA polymerase). The RVFV N and L proteins are responsible for viral replication and transcription. G2 and G1 are glycoproteins that enter the viral envelope to form a ribonucleoprotein complex (RNP) with the N protein. Additionally, the RNP and L protein jointly package the viral particle. NSm and NSs are nonstructural proteins[1].

Technical Parameters

  • Species Virus
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • RVFV G1 (P156-T581)
      Accession # ABD38821
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    Rift Valley fever virus (RVFV) (strain MP12) glycoprotein/G1 Protein

  • AA Sequence

    PHLRNRPGKGHNYIDGMTQEDATCKPVTYAGACSSFDVLLEKGKFPLFQSYAHHRTLLEAVHDTIIAKADPPSCDLLSAHGNPCMKEKLVMKTHCPNDYQSAHHLNNDGKMASVKCPPKYELTEDCNFCRQMTGASLKKGSYPLQDLFCQSSEDDGSKLKTKMKGVCEVGVQALKKCDGQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFEHKGQYKGTMDSGQTKRELKSFDISQCPKIGGHGSKKCTGDAAFCSAYECTAQYANAYCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRELSAKPIQRVEPCTTCITKCEPHGLVVRSTGFKISSAVACASGVCVTGSQSPSTEITLKYPGISQSSGGDIGVHMAHDDQSVSSKIVAHCPPQDPCLVHDCIVCAHGLINYQCHT

  • Predicted Molecular Mass

    47.8 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00