glycoprotein/G1 Protein, RVFV (sf9, His)
RVFV is an RNA virus in the Phlebovirus genus of the Bunyaviridae family. The virus is enveloped, spherical, and has a diameter of approximately 80-120 nm. G1 is a glycoprotein that enter the viral envelope to form a ribonucleoprotein complex (RNP) with the N protein. RVFV is a high-risk pathogen that can induce fatal encephalitis and hemorrhagic fever in humans and ruminants. glycoprotein/G1 Protein, RVFV (sf9, His) is the recombinant Virus-derived glycoprotein/G1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Virus
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
RVFV is an RNA virus in the Phlebovirus genus of the Bunyaviridae family. The virus is enveloped, spherical, and has a diameter of approximately 80-120 nm. G1 is a glycoprotein that enter the viral envelope to form a ribonucleoprotein complex (RNP) with the N protein. RVFV is a high-risk pathogen that can induce fatal encephalitis and hemorrhagic fever in humans and ruminants[1][2]. glycoprotein/G1 Protein, RVFV (sf9, His) is the recombinant Virus-derived glycoprotein/G1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
The RVFV viral envelope is coated with surface glycoprotein projections of 10 nm in diameter, while the nucleic acids that comprise the viral genome are located within the nucleocapsid. The nucleic acids that make up the RVFV genome are single-stranded antisense RNA molecules that consist of small (S), medium (M), and large (L) segments. The S segment, which is comprised of 1690 nucleotides (nt), encodes the N and NSs proteins; the M segment (3885 nt) encodes the G2 (Gn), G1 (Gc), and NSm proteins; and the L segment (6404 nt) encodes the L protein (an RNA-dependent RNA polymerase). The RVFV N and L proteins are responsible for viral replication and transcription. G2 and G1 are glycoproteins that enter the viral envelope to form a ribonucleoprotein complex (RNP) with the N protein. Additionally, the RNP and L protein jointly package the viral particle. NSm and NSs are nonstructural proteins[1].
Technical Parameters
-
Species Virus
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
ABD38821 (P156-T581)
-
Gene ID/
-
Molecular Construction
-
N-term
-
RVFV G1 (P156-T581)
Accession # ABD38821 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
Rift Valley fever virus (RVFV) (strain MP12) glycoprotein/G1 Protein
-
AA Sequence
PHLRNRPGKGHNYIDGMTQEDATCKPVTYAGACSSFDVLLEKGKFPLFQSYAHHRTLLEAVHDTIIAKADPPSCDLLSAHGNPCMKEKLVMKTHCPNDYQSAHHLNNDGKMASVKCPPKYELTEDCNFCRQMTGASLKKGSYPLQDLFCQSSEDDGSKLKTKMKGVCEVGVQALKKCDGQLSTAHEVVPFAVFKNSKKVYLDKLDLKTEENLLPDSFVCFEHKGQYKGTMDSGQTKRELKSFDISQCPKIGGHGSKKCTGDAAFCSAYECTAQYANAYCSHANGSGIVQIQVSGVWKKPLCVGYERVVVKRELSAKPIQRVEPCTTCITKCEPHGLVVRSTGFKISSAVACASGVCVTGSQSPSTEITLKYPGISQSSGGDIGVHMAHDDQSVSSKIVAHCPPQDPCLVHDCIVCAHGLINYQCHT
-
Predicted Molecular Mass
47.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)