GPA33 Protein, Human (HEK293, His-Avi)
The GPA33 protein may play a role in fundamental cellular processes, particularly in intercellular recognition and signaling, suggesting its involvement in intercellular communication. The exact mechanism by which GPA33 functions in these processes remains an area of interest, emphasizing its potential importance in mediating molecular interactions that contribute to cellular responses. GPA33 Protein, Human (HEK293, His-Avi) is the recombinant human-derived GPA33 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The GPA33 protein may play a role in fundamental cellular processes, particularly in intercellular recognition and signaling, suggesting its involvement in intercellular communication. The exact mechanism by which GPA33 functions in these processes remains an area of interest, emphasizing its potential importance in mediating molecular interactions that contribute to cellular responses. GPA33 Protein, Human (HEK293, His-Avi) is the recombinant human-derived GPA33 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
The GPA33 protein is implicated in potentially playing a role in cell-cell recognition and signaling, suggesting its involvement in fundamental cellular processes related to intercellular communication. The precise mechanisms by which GPA33 operates in cell-cell recognition and signaling remain areas of interest, underscoring its potential significance in mediating molecular interactions that contribute to cellular responses. The versatile nature of GPA33 in these processes highlights its potential role in coordinating cellular recognition events and modulating signaling cascades, emphasizing the need for further exploration to elucidate its specific functions and molecular mechanisms.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
Q99795 (I22-V235)
-
Molecular Construction
-
N-term
-
GPA33 (I22-V235)
Accession # Q99795 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
GPA33; Glycoprotein A33 (Transmembrane); Glycoprotein A33; Cell Surface A33 Antigen; A33; Transmembrane Glycoprotein A33
-
AA Sequence
ISVETPQDVLRASQGKSVTLPCTYHTSTSSREGLIQWDKLLLTHTERVVIWPFSNKNYIHGELYKNRVSISNNAEQSDASITIDQLTMADNGTYECSVSLMSDLEGNTKSRVRLLVLVPPSKPECGIEGETIIGNNIQLTCQSKEGSPTPQYSWKRYNILNQEQPLAQPASGQPVSLKNISTDTSGYYICTSSNEEGTQFCNITVAVRSPSMNV
-
Predicted Molecular Mass
26.5 kDa
-
Molecular Weight
Approximately 28-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)